close all open/close all

CDS information : Salino_00230


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction22,386 / 23,057 / + [in whole cluster]
22,386 / 23,057 / + [in contig]
Location22386..23057 [in whole cluster]
22386..23057 [in contig]
TypeCDS
Length672 bp (223 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)alkylated DNA repair protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[alkylated DNA repair protein]
MGRMNGELFPRGRAEIVPGAVHVPDWLGTGRQHELLDACRGWARPPAGLRTVHVPGGGTM
SARQVCLGRHWVPYRYTGTAVDGDGAPVKPFPGWLDELAQSALAAAYGEAAEPDPYDVAL
VNFYAEGTRMGMHRDAEEESGAPVVSLSLGDSCVFRFGNPENRGRPYQDVELRSGDLFVF
GGPARLAYHGVPRVKAHSGPPGLGLTGRLNITLRVSGLPAPAH
selected fasta
>[alkylated DNA repair protein]
ATGGGGAGGATGAACGGCGAGCTGTTCCCCCGCGGCCGGGCCGAGATCGTCCCCGGTGCG
GTGCACGTCCCCGACTGGCTCGGCACCGGGCGCCAGCACGAACTCCTGGACGCCTGCCGT
GGCTGGGCCCGCCCGCCCGCCGGACTGCGCACGGTGCACGTGCCCGGCGGCGGCACCATG
AGCGCCCGGCAGGTCTGCCTCGGCCGCCACTGGGTGCCCTACCGCTACACCGGGACCGCG
GTCGACGGCGACGGCGCCCCCGTCAAGCCCTTCCCCGGCTGGCTGGACGAGCTGGCGCAG
AGCGCACTGGCCGCGGCCTACGGCGAGGCCGCCGAACCGGACCCGTACGACGTCGCCCTG
GTCAACTTCTATGCCGAGGGCACCCGGATGGGCATGCACCGGGACGCCGAGGAGGAGTCC
GGGGCGCCCGTGGTCTCGCTCAGCCTCGGCGACTCCTGCGTCTTCCGCTTCGGCAACCCC
GAGAACCGCGGCCGGCCCTACCAGGACGTCGAACTGCGCAGCGGCGACCTCTTCGTCTTC
GGCGGCCCCGCCCGGCTCGCCTACCACGGGGTGCCCCGGGTCAAGGCGCACAGCGGGCCG
CCCGGGCTTGGCCTCACCGGGCGGCTCAACATCACCCTGCGCGTGAGCGGACTGCCCGCC
CCGGCACACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005123 Oxoglutarate/iron-dependent dioxygenase (Domain)
 [19-214]  5.6e-44 PF13532
PF13532   2OG-FeII_Oxy_2
 [115-217]  PS51471
PS51471   FE2OG_OXY
SignalP No significant hit
TMHMM No significant hit