close all open/close all

CDS information : Salino_00240


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction23,096 / 24,337 / + [in whole cluster]
23,096 / 24,337 / + [in contig]
Location23096..24337 [in whole cluster]
23096..24337 [in contig]
TypeCDS
Length1,242 bp (413 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)ROK family transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[ROK family transcriptional regulator]
MNGKATDGELGAKQSRHRLERGRGALGPALALVHTGQAPTRSVLTSRLGVTRATAGAVAA
ELESLGLIRVDPRPAAASGTQGRPSHRLEIAEEGPVVLAGQVHADGYRAALVGLGGRIVA
TAPGCVTVGADPSYVLGTLVAEGVRLLEESGRRCAGVGLAVPSAVAEPGGEALNPLHLEW
PAGAPVRRLFTEAVRQHGLGVPVFTANDINLAALAEHRHGAGREAGNLLCVATGHRGVGG
ALVVDGRLHLGSAGLALEVGHITVEPQGRPCHCGRQGCLDVETDPLAFLRAAGREPAPGR
SPIEEATRLLAEEAGEPAVRAAIEALTDRLGRGLAALVNILNPDRIILGGLHRSLLEAAG
PRLRGTVAQDSLWGLSGSVPVRACSLAHNSLVGAAELAWQPVLEDPLSVLVPA
selected fasta
>[ROK family transcriptional regulator]
ATGAACGGCAAGGCGACGGACGGGGAACTCGGCGCGAAGCAGTCCCGGCACCGTCTGGAG
CGGGGCCGCGGCGCCCTCGGACCCGCGCTCGCGCTCGTCCACACCGGGCAGGCGCCCACC
CGCTCGGTGCTCACCTCCCGGCTCGGCGTGACCCGGGCGACCGCCGGGGCCGTCGCCGCC
GAGCTGGAGAGCCTCGGCCTGATCCGTGTCGACCCCCGCCCGGCCGCCGCCTCGGGCACC
CAGGGCCGCCCCTCGCACCGGCTGGAGATCGCGGAGGAGGGCCCCGTCGTCCTCGCGGGG
CAGGTGCACGCCGACGGCTACCGCGCGGCCCTGGTCGGACTCGGCGGCCGGATCGTCGCC
ACCGCGCCCGGCTGCGTCACGGTCGGCGCGGACCCCTCGTACGTACTGGGCACGCTGGTG
GCCGAGGGGGTGCGTCTGCTGGAGGAGAGCGGGCGGCGCTGTGCGGGCGTGGGGCTCGCG
GTGCCCTCGGCGGTGGCCGAGCCCGGGGGAGAGGCGCTCAACCCGCTGCATCTGGAGTGG
CCCGCCGGTGCGCCGGTACGGCGGCTCTTCACCGAGGCGGTGCGTCAACACGGCCTCGGC
GTACCGGTGTTCACCGCCAATGACATCAACCTCGCGGCCCTGGCCGAGCATCGGCACGGC
GCGGGCCGGGAGGCGGGCAATCTGCTCTGCGTGGCCACCGGGCACCGCGGGGTCGGCGGC
GCCCTGGTGGTCGACGGGCGGCTGCACCTGGGCAGCGCCGGACTCGCCCTGGAGGTCGGC
CACATCACCGTGGAGCCGCAGGGGCGGCCCTGCCACTGCGGGCGGCAGGGCTGTCTGGAT
GTGGAGACCGACCCGCTCGCCTTCCTGCGGGCCGCGGGACGCGAACCCGCCCCGGGCCGC
TCGCCCATCGAGGAGGCCACCCGGCTGCTCGCCGAGGAGGCCGGGGAGCCCGCGGTGCGC
GCCGCCATCGAGGCGCTGACCGACCGCCTCGGGCGGGGACTCGCCGCCCTGGTGAACATC
CTCAACCCGGACCGCATCATCCTCGGCGGCCTGCACCGCTCGCTTCTGGAGGCCGCGGGC
CCCCGGCTGCGCGGCACCGTGGCGCAGGACAGCCTGTGGGGCCTCAGCGGGAGCGTGCCC
GTGCGGGCCTGCTCGCTCGCCCACAACAGCCTGGTCGGGGCGGCCGAGTTGGCCTGGCAG
CCGGTCCTGGAGGACCCGCTCTCGGTGCTCGTGCCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000600 ROK (Family)
 [144-280]  4.70000000000001e-22 PF00480
PF00480   ROK
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [29-96]  0.0005 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit