close all open/close all

CDS information : Salino_00250


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction24,707 / 25,138 / + [in whole cluster]
24,707 / 25,138 / + [in contig]
Location24707..25138 [in whole cluster]
24707..25138 [in contig]
TypeCDS
Length432 bp (143 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)protease inhibitor precursor
Gene
Gene (GenBank)sti1
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[protease inhibitor precursor]
MHRTARLAATISLAAAALALPLAQASAAPQAAPASLYAPSELVLTLAHGTSAADSAPARA
VTLSCGPTARGSHPDPAAACAELTAAQGDFDALAGSGQAVCDRRYAPVVITVSGVWQGKR
TAYERTFSNECVKNSQGRTVFAF
selected fasta
>[protease inhibitor precursor]
ATGCACCGGACCGCGCGCCTCGCAGCGACGATCTCGCTGGCGGCAGCAGCCCTCGCCCTC
CCCCTCGCCCAGGCCTCCGCCGCACCCCAGGCGGCCCCGGCGAGCCTGTACGCCCCCTCG
GAGCTCGTCCTCACCCTCGCGCACGGCACCTCCGCCGCCGACTCCGCGCCCGCCCGCGCG
GTGACCCTGAGCTGCGGGCCCACCGCCCGCGGCAGCCACCCGGACCCGGCCGCCGCCTGC
GCCGAACTCACCGCGGCCCAGGGCGACTTCGACGCCCTCGCCGGCTCCGGGCAGGCCGTC
TGCGACCGCCGGTACGCCCCCGTGGTGATCACCGTCTCCGGGGTCTGGCAGGGCAAGCGG
ACCGCCTACGAACGCACCTTCTCCAACGAGTGCGTCAAGAACTCTCAGGGGCGGACCGTC
TTCGCCTTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000691 Proteinase inhibitor I16, Streptomyces subtilisin-type inhibitor (Family)
 [39-65]  2.70000183580794e-25 PR00294 [101-117]  2.70000183580794e-25 PR00294 [118-134]  2.70000183580794e-25 PR00294
PR00294   SSBTLNINHBTR
IPR020054 Proteinase inhibitor I16, Streptomyces subtilisin-type inhibitor, conserved site (Conserved_site)
 [65-83]  PS00999
PS00999   SSI
IPR023549 Subtilisin inhibitor (Domain)
 [42-131]  PD004028
PD004028   Prot_inh_SSI
 [37-130]  1.29999999999998e-38 PF00720
PF00720   SSI
 [37-143]  1.79999754022375e-36 SSF55399
SSF55399   Prot_inh_SSI
 [37-143]  6.90000000000001e-35 G3DSA:3.30.350.10
G3DSA:3.30.350.10   Prot_inh_SSI
SignalP
 [1-27]  1 Signal
Bacteria, Gram-positive   
 [1-27]  1 Signal
Bacteria, Gram-negative   
 [1-27]  1 Signal
Eukaryota   
TMHMM No significant hit