close all open/close all

CDS information : Salino_00270


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction25,854 / 26,630 / + [in whole cluster]
25,854 / 26,630 / + [in contig]
Location25854..26630 [in whole cluster]
25854..26630 [in contig]
TypeCDS
Length777 bp (258 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)ABC transporter ATP-binding protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[ABC transporter ATP-binding protein]
MTTETAVRTAARVVDAVKVYGSGDTEVRALDGVSVDFPAGRFTAIMGPSGSGKSTLLHCA
AGLDSLSSGAAFIGGTELGALDDRRLTLLRRDRVGFVFQAFNLVPTLTVAENITLPMDLA
GTRADREAAEWIDALIDIVGLRDRLHHRPAELSGGQQQRVAVARAFASRPEVVFADEPTG
NLDSRSGEEVLGLLGRAVRERGRTVVMVTHDPVAAAHADEVVFLADGRLVDRMPAPSAER
VLDRLKAFDARAAKKVTP
selected fasta
>[ABC transporter ATP-binding protein]
ATGACCACCGAGACCGCCGTCCGCACCGCGGCCCGGGTCGTGGACGCCGTGAAGGTCTAC
GGCAGCGGGGACACCGAGGTACGGGCCCTGGACGGTGTCAGCGTCGACTTCCCGGCCGGG
CGCTTCACCGCGATCATGGGCCCCTCGGGCTCCGGCAAGTCCACCCTGCTGCACTGCGCG
GCCGGTCTCGACAGCCTCAGCTCCGGTGCCGCCTTCATCGGCGGCACCGAACTGGGCGCC
CTCGACGACCGGCGGCTGACCCTGCTGCGCCGCGACCGCGTCGGCTTCGTCTTCCAGGCC
TTCAACCTGGTGCCCACGCTGACCGTCGCGGAGAACATCACCCTGCCCATGGACCTCGCG
GGCACCCGCGCCGACCGCGAGGCGGCCGAGTGGATCGACGCCCTGATCGACATCGTCGGC
CTGCGCGACCGGCTGCACCACCGGCCCGCCGAACTCTCCGGCGGCCAGCAGCAACGCGTC
GCCGTGGCACGGGCGTTCGCGAGCCGCCCCGAGGTCGTCTTCGCCGACGAGCCCACCGGG
AACCTCGACTCCCGCTCCGGCGAGGAGGTCCTCGGACTGCTCGGCCGGGCGGTACGCGAG
CGGGGGCGCACCGTCGTCATGGTCACCCACGACCCGGTGGCCGCCGCCCACGCCGACGAG
GTCGTCTTCCTCGCCGACGGGCGGCTGGTCGACCGGATGCCCGCGCCGAGCGCGGAACGC
GTGCTCGACCGGCTGAAGGCCTTCGACGCGCGGGCCGCGAAGAAGGTGACGCCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [11-251]  PS50893
PS50893   ABC_TRANSPORTER_2
 [54-179]  1.99999999999999e-19 PF00005
PF00005   ABC_tran
IPR003593 AAA+ ATPase domain (Domain)
 [39-228]  4.19999771339581e-18 SM00382
SM00382   AAA
IPR017871 ABC transporter, conserved site (Conserved_site)
 [152-166]  PS00211
PS00211   ABC_TRANSPORTER_1
SignalP
 [1-16]  0.141 Signal
Eukaryota   
TMHMM No significant hit