close all open/close all

CDS information : Salino_00280


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction26,627 / 29,197 / + [in whole cluster]
26,627 / 29,197 / + [in contig]
Location26627..29197 [in whole cluster]
26627..29197 [in contig]
TypeCDS
Length2,571 bp (856 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)ABC transport system integral membrane protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[ABC transport system integral membrane protein]
MSAARASARLSLASLRAHKRRFAGTFLAVLLGVSFLAGTLVMGDTLRAGFDTLFGDATRG
TDAVVRSADTVTTPGESQGVRSPVPTSLAARIERVPEVAAAVPRIEGAGQLVGKNGKPIG
GQGPPTLAGNWITDRALNPYQLAEGRAPSKTGEVVVNRGAAKRGGLGIGDTTTLRTPDPV
KVRLVGLARFGGEDGMAQVTYTGMTLGDAQKYLTPRPGEAASIQVRAGPGTGQRELVEAL
TPVLPEGVEAITGQESAEENTEMISGQFLTLFTTFLLVFSGVALLVATFSIHNTFAIVVA
QRSRENALLRALGASRRQVTAATLTEAGAVAVAASLTGLLGGIGIAAGLQALFPAIGFPF
PEGELVISGVSLWLPVAVGVLVCLASALLPALRAGRTAPLAALRETAVDTSGASRARART
GAALGLAAVAATLTGVLLTPSLWLAGLGAVLALAAFVVLGPVAATTAVRALGAPLDRLRG
LTGRLARRNALRSPKRTAATAGALMIGVAVVSLFTVFGASLKATMNQTVDRSFAGDVAVS
TPSFGAGGSGLSPRLAPALAERPEVATAVGLGRGVAEVDGRGRALTVTDPAALERTFHLG
TVRGDLSALGTDGIALAAPEAEKAGLEPGSRTRLAFTDGSRETFTVRAVYDRSELVGDYV
LTREAWAPHRAQDADTLVAVTFADGVGQAAGSAAVEKVAARYGNPEVQTRGEYAESSAAG
IDMMLTLVYALLALAVLIALLGIANTLTLAIHERTRELGLLRAVGQTRAQLRAMVRWESV
LVAAFGTAGGLGLGGFLGWVLVAASDGASESAFAFALPPAQLLVVALVGLAAGALAGLRP
ARRAARLNVLGAIATE
selected fasta
>[ABC transport system integral membrane protein]
ATGAGCGCCGCCCGTGCCTCGGCGCGGCTCAGCCTCGCCTCGCTGCGGGCCCACAAGCGC
CGCTTCGCGGGCACCTTCCTCGCCGTACTGCTCGGGGTCTCCTTCCTGGCCGGCACCCTG
GTCATGGGGGACACCCTGCGGGCCGGTTTCGACACCCTGTTCGGCGACGCCACCCGCGGC
ACCGACGCCGTCGTACGCAGCGCCGACACCGTCACCACGCCCGGCGAGAGCCAGGGCGTG
CGCAGCCCCGTGCCGACCTCGCTCGCCGCCCGGATCGAGCGGGTGCCCGAGGTCGCCGCG
GCGGTGCCGCGCATCGAGGGCGCCGGACAGCTCGTCGGGAAGAACGGCAAGCCCATCGGC
GGCCAGGGACCGCCCACCCTGGCCGGGAACTGGATCACCGACCGCGCGCTCAATCCGTAC
CAACTCGCCGAGGGACGCGCCCCGTCGAAGACCGGTGAGGTCGTCGTCAACCGGGGAGCC
GCGAAGCGGGGCGGCCTCGGCATCGGCGACACCACCACGTTGCGCACCCCCGATCCGGTG
AAGGTGCGCCTGGTGGGCCTCGCCCGCTTCGGCGGCGAGGACGGCATGGCCCAGGTGACC
TACACCGGCATGACCCTGGGCGACGCGCAGAAGTACCTGACACCGCGGCCCGGCGAGGCC
GCGAGCATCCAGGTGCGGGCCGGGCCCGGCACCGGTCAGCGGGAACTGGTCGAGGCGCTG
ACTCCCGTACTGCCCGAGGGAGTCGAGGCGATCACCGGCCAGGAGTCCGCCGAGGAGAAC
ACCGAGATGATCTCCGGGCAGTTCCTGACGCTCTTCACCACCTTCCTGCTGGTCTTCTCC
GGCGTCGCCCTGCTCGTCGCCACCTTCTCCATCCACAACACCTTCGCCATCGTCGTCGCC
CAGCGCTCCCGCGAGAACGCGCTGCTGCGGGCGCTCGGCGCCTCCCGGCGGCAGGTCACC
GCCGCCACCCTGACCGAGGCGGGCGCCGTCGCGGTGGCCGCCTCGCTCACCGGCCTGCTC
GGCGGCATCGGCATCGCGGCCGGACTCCAGGCGCTCTTCCCGGCCATCGGATTCCCCTTC
CCGGAGGGGGAGTTGGTGATCAGCGGAGTCTCGCTGTGGCTGCCGGTCGCGGTCGGCGTC
CTCGTCTGCCTGGCCTCCGCGCTGCTGCCCGCCCTGCGGGCCGGGCGCACCGCGCCGCTC
GCCGCGCTGCGGGAGACGGCCGTGGACACCTCCGGCGCCTCCCGGGCCCGCGCCCGCACC
GGCGCCGCCCTCGGCCTCGCCGCGGTGGCCGCCACCCTCACCGGGGTGCTCCTCACGCCC
TCGCTGTGGCTGGCGGGCCTCGGCGCGGTCCTCGCGCTCGCCGCCTTCGTGGTCCTCGGT
CCGGTGGCCGCCACCACCGCGGTACGGGCCCTCGGCGCGCCCCTGGACCGGCTGCGCGGG
CTCACCGGACGGCTCGCCCGGCGCAACGCGCTGCGCAGCCCGAAGCGGACCGCGGCCACC
GCGGGCGCGCTCATGATCGGGGTCGCGGTGGTCTCGCTCTTCACCGTCTTCGGCGCCTCG
CTGAAGGCGACCATGAACCAGACGGTGGACCGCTCCTTCGCCGGTGACGTCGCCGTCAGC
ACCCCCTCCTTCGGCGCGGGCGGCAGCGGACTCAGCCCCCGCCTCGCGCCCGCCCTCGCC
GAGCGGCCCGAGGTCGCCACGGCGGTCGGCCTCGGCCGCGGGGTGGCCGAGGTGGACGGC
CGGGGCCGCGCCCTGACCGTCACCGACCCGGCGGCCCTGGAGCGCACCTTCCACCTGGGC
ACGGTCCGCGGCGACCTGAGCGCCCTCGGCACCGACGGCATCGCCCTCGCCGCCCCCGAG
GCCGAGAAGGCGGGACTGGAACCCGGCTCCCGCACCCGGCTCGCCTTCACCGACGGCAGC
CGGGAGACCTTCACCGTCCGCGCCGTCTACGACCGCTCCGAACTGGTCGGCGACTACGTC
CTCACCCGCGAGGCCTGGGCCCCGCACCGGGCACAGGACGCGGACACCCTGGTCGCCGTC
ACCTTCGCGGACGGGGTGGGCCAGGCGGCCGGCAGCGCCGCGGTCGAGAAGGTCGCGGCG
CGCTACGGCAACCCCGAGGTGCAGACCCGCGGCGAGTACGCCGAGTCCTCCGCGGCCGGC
ATCGACATGATGCTCACCCTGGTCTACGCGCTGCTCGCCCTCGCCGTACTGATCGCCCTG
CTCGGCATCGCCAACACGCTGACCCTGGCGATCCACGAGCGCACCCGGGAGCTGGGGCTG
CTGCGGGCCGTCGGGCAGACCCGGGCCCAGCTGCGGGCCATGGTCCGCTGGGAGTCGGTC
CTGGTCGCGGCCTTCGGCACGGCGGGCGGGCTCGGGCTCGGCGGCTTCCTCGGCTGGGTC
CTGGTGGCGGCCTCGGACGGGGCGAGCGAGAGCGCCTTCGCCTTCGCCCTGCCGCCCGCG
CAACTGCTCGTGGTGGCGCTGGTCGGACTCGCGGCCGGGGCCCTCGCGGGGCTGCGCCCG
GCCCGGCGGGCGGCCCGCCTGAACGTCCTCGGGGCCATCGCCACCGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003838 Permease FtsX-like (Domain)
 [278-398]  9.8e-19 PF02687 [730-848]  1.8e-20 PF02687
PF02687   FtsX
IPR025857 MacB-like periplasmic core domain (Domain)
 [12-241]  2.4e-22 PF12704 [486-690]  3.1e-12 PF12704
PF12704   MacB_PCD
SignalP
 [1-43]  0.983 Signal
Bacteria, Gram-negative   
 [1-43]  0.999 Signal
Bacteria, Gram-positive   
 [1-43]  0.905 Signal
Eukaryota   
TMHMM
 [21-43]  Transmembrane (i-o) [278-300]  Transmembrane (o-i) [327-349]  Transmembrane (i-o) [369-391]  Transmembrane (o-i) [423-445]  Transmembrane (i-o) [450-472]  Transmembrane (o-i) [497-519]  Transmembrane (i-o) [727-749]  Transmembrane (o-i) [779-801]  Transmembrane (i-o) [816-838]  Transmembrane (o-i)
Transmembrane 10