close all open/close all

CDS information : Salino_00290


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction29,788 / 29,273 / - [in whole cluster]
29,788 / 29,273 / - [in contig]
Locationcomplement(29273..29788) [in whole cluster]
complement(29273..29788) [in contig]
TypeCDS
Length516 bp (171 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)regulatory protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[regulatory protein]
MISKPSRHCTVELQALPSRISQVRRIFSAQLRYWRLDPLIDRVALGVTELLTNVHRHVRT
DKTCTVRIELELDRLTVSVHDRDPHLPLVHEAEPGATGGRGLALIAAVSESWGVQPLGDT
GKTVWFTLPTPPRVPLFATWQVPGAATTGPFAELEPVAMAPHAPARSAVVS
selected fasta
>[regulatory protein]
GTGATCAGCAAGCCGAGCAGGCACTGCACGGTGGAGCTCCAGGCCCTGCCGTCGCGAATC
AGCCAGGTCCGCAGAATCTTTTCGGCGCAACTGCGCTACTGGCGTCTCGATCCGCTCATT
GACCGAGTGGCACTCGGAGTCACCGAGTTGCTCACCAATGTGCATCGACACGTACGGACC
GACAAGACATGCACCGTCCGCATCGAGCTGGAGCTCGACCGGCTGACGGTATCCGTCCAC
GACCGAGATCCGCACCTCCCCCTGGTGCACGAGGCGGAACCCGGAGCCACCGGGGGCCGG
GGCCTCGCGCTGATCGCCGCGGTCAGCGAGAGCTGGGGAGTGCAACCCCTGGGCGACACG
GGAAAGACGGTGTGGTTCACCCTGCCCACACCGCCTCGGGTGCCGCTCTTCGCCACCTGG
CAGGTTCCCGGGGCGGCGACGACCGGGCCGTTCGCGGAGCTGGAACCCGTGGCCATGGCC
CCGCACGCTCCCGCCCGGTCGGCCGTTGTCAGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003594 ATPase-like, ATP-binding domain (Domain)
 [2-133]  1.69999922284049e-10 SSF55874
SSF55874   ATP_bd_ATPase
 [40-132]  0.0220000021756082 SM00387
SM00387   HATPase_c
SignalP No significant hit
TMHMM No significant hit