close all open/close all

CDS information : Salino_00310


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction30,592 / 31,737 / + [in whole cluster]
30,592 / 31,737 / + [in contig]
Location30592..31737 [in whole cluster]
30592..31737 [in contig]
TypeCDS
Length1,146 bp (381 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)pyridoxal-phosphate dependent enzyme
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[pyridoxal-phosphate dependent enzyme]
MRSAAQDRPGPALPTLDADRSDAAYRDWLKEAVRKVQADANRSADTHLLRFPLPEHWGID
LYLKDESTHPTGSLKHRLARSLFLYGLCNGWIRPDRPVIEASSGSTAVSEAYFAGLIGVP
FIAVMPRTTSAEKCRLIEFHGGQCHFVDDSRTMYEESAALAARTGGHYMDQFTYAERATD
WRGNNNIAESIYRQLERERYPEPAWIVATAGTGGTSATLARYVHYMQYDTRICVADPENS
CFFEGWTTDSAEAVCESGSRIEGIGRPRMEPSFVPGAIDRMMKVPDAAAIATVRALEAAL
GRKAGGSTGTGLWGALKIVAEMVGQGRTGSVVTLLCDPGERYLDKYYSDDWLTAQALDIR
PYAAALNTFLATGSWPEETAI
selected fasta
>[pyridoxal-phosphate dependent enzyme]
GTGCGCAGTGCAGCACAGGACCGTCCAGGCCCCGCCCTGCCGACGCTCGACGCCGACCGC
AGCGACGCCGCGTACCGGGACTGGCTGAAAGAGGCGGTGCGCAAGGTCCAGGCCGACGCG
AACCGGTCCGCCGATACCCATCTGCTGCGCTTTCCGCTGCCCGAGCACTGGGGCATCGAC
CTCTACCTCAAGGACGAGTCCACCCACCCCACCGGCAGCCTCAAGCACCGGCTCGCCCGC
TCGCTGTTCCTGTACGGGCTGTGCAACGGCTGGATCCGCCCCGACCGCCCGGTCATCGAG
GCCTCCAGCGGCTCCACCGCGGTGTCCGAGGCCTACTTCGCCGGTCTCATCGGGGTGCCC
TTCATCGCGGTGATGCCCCGTACGACCAGCGCGGAGAAGTGCCGCCTGATCGAATTCCAC
GGCGGGCAGTGCCACTTCGTCGACGACTCGCGCACGATGTACGAGGAGTCGGCCGCCCTC
GCGGCGCGTACCGGGGGCCACTACATGGACCAGTTCACCTACGCCGAGCGCGCCACGGAC
TGGCGCGGCAACAACAACATCGCCGAGTCGATCTACCGGCAGCTGGAGCGGGAACGCTAC
CCGGAGCCCGCCTGGATCGTCGCCACCGCCGGTACGGGCGGTACCTCGGCGACCCTCGCC
CGCTACGTTCACTACATGCAGTACGACACCCGTATCTGCGTCGCCGACCCGGAGAACTCC
TGCTTCTTCGAGGGCTGGACCACCGACAGCGCCGAGGCGGTCTGCGAGAGCGGTTCGCGG
ATCGAGGGCATCGGGCGGCCCCGGATGGAGCCGAGCTTCGTGCCCGGGGCCATCGACCGG
ATGATGAAGGTCCCCGACGCGGCCGCCATCGCCACCGTACGCGCCCTGGAGGCCGCCCTC
GGGCGCAAGGCGGGCGGCTCCACCGGCACCGGCCTGTGGGGCGCCCTGAAGATCGTGGCC
GAGATGGTCGGCCAGGGCCGCACCGGCAGCGTGGTCACCCTGCTCTGCGACCCGGGGGAG
CGCTACCTCGACAAGTACTACTCCGACGACTGGCTCACCGCCCAGGCCCTGGACATCCGC
CCCTACGCCGCGGCGCTCAACACCTTCCTCGCCACGGGCAGTTGGCCCGAGGAGACCGCC
ATCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001926 Pyridoxal phosphate-dependent enzyme, beta subunit (Domain)
 [23-356]  8.00002659346736e-71 SSF53686
SSF53686   PyrdxlP-dep_enz_bsu
 [46-337]  9.40000000000003e-41 PF00291
PF00291   PALP
SignalP No significant hit
TMHMM No significant hit