close all open/close all

CDS information : Salino_00320


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction32,696 / 31,851 / - [in whole cluster]
32,696 / 31,851 / - [in contig]
Locationcomplement(31851..32696) [in whole cluster]
complement(31851..32696) [in contig]
TypeCDS
Length846 bp (281 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)DeoR family transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[DeoR family transcriptional regulator]
MSENQNLLAEQRRALILDEVRRRGGARVNELTRRLGVSDMTVRRDLDALARQGMVEKVHG
GAVPVFEASTHEPGFEAKSGLELSAKEDIARAAAAFVAPGTAIALSGGTTTYALAHHLLD
VADLTVVTNSVRVADVFHSAQQVSGLRADSATVVLTGGVRTPSDSLVGPVADQAIGSLHF
DVLFLGVHGISAEAGLSTPNLAEAETNRRLVQSARRVVVVADHTKWGTVGLSSFAKLDEV
DTLVTDAGLPAATRAEVSEQLRLVVAGEPEPTEPAAATEGG
selected fasta
>[DeoR family transcriptional regulator]
GTGAGCGAGAACCAGAACCTCCTCGCCGAACAGCGGCGCGCGCTCATCCTCGACGAGGTG
CGCAGGCGCGGCGGCGCGCGGGTCAACGAACTCACGCGCAGGCTCGGGGTCTCGGACATG
ACGGTCCGCCGCGACCTGGACGCCCTCGCCCGCCAGGGCATGGTGGAGAAGGTGCACGGC
GGCGCGGTGCCGGTCTTCGAGGCGAGCACCCATGAGCCGGGCTTCGAGGCCAAGTCGGGC
CTGGAGCTGAGCGCCAAGGAGGACATCGCCCGCGCCGCGGCCGCCTTCGTCGCCCCGGGC
ACCGCGATCGCGCTCTCCGGCGGTACGACGACCTACGCGCTCGCGCACCATCTCCTGGAC
GTGGCGGACCTGACGGTGGTCACCAACTCGGTACGGGTGGCCGATGTCTTCCACAGCGCG
CAGCAGGTCTCGGGGCTGCGCGCGGACTCGGCGACCGTGGTGCTGACCGGCGGGGTGCGC
ACCCCCTCCGACTCCCTGGTGGGGCCGGTGGCGGACCAGGCCATCGGCTCGCTCCACTTC
GATGTGCTCTTCCTCGGCGTGCACGGCATATCGGCCGAGGCGGGCCTGTCCACCCCGAAC
CTCGCCGAGGCGGAGACCAACCGCCGCCTGGTGCAGTCGGCCCGGCGGGTGGTGGTGGTC
GCCGACCACACCAAGTGGGGCACCGTGGGCCTGAGTTCCTTCGCCAAGCTCGACGAGGTG
GACACCCTGGTCACGGACGCCGGGCTGCCCGCGGCGACGCGCGCCGAGGTCTCCGAGCAG
CTGCGCCTCGTGGTGGCGGGTGAGCCCGAGCCCACCGAACCCGCCGCGGCGACCGAGGGC
GGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001034 HTH DeoR N-terminal domain (Domain)
 [30-44]  1.69999922284049e-09 PR00037 [44-62]  1.69999922284049e-09 PR00037
PR00037   HTHLACR
 [9-64]  PS51000
PS51000   HTH_DEOR_2
 [12-63]  9.8e-17 PF08220
PF08220   HTH_DeoR
 [12-64]  5.00000909915354e-20 SM00420
SM00420   HTH_DEOR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [11-60]  2.9e-11 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR014036 DeoR C-terminal sensor domain (Domain)
 [83-247]  2.59999999999998e-53 PF00455
PF00455   DeoRC
IPR018356 Transcription regulator, HTH DeoR-type, conserved site (Conserved_site)
 [12-46]  PS00894
PS00894   HTH_DEOR_1
SignalP No significant hit
TMHMM No significant hit