close all open/close all

CDS information : Salino_00330


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction32,952 / 35,351 / + [in whole cluster]
32,952 / 35,351 / + [in contig]
Location32952..35351 [in whole cluster]
32952..35351 [in contig]
TypeCDS
Length2,400 bp (799 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)integral membrane protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[integral membrane protein]
MDRATEAAPPGPSAPAEEPALELLVHGVGGTTPAEMLDDPRTVRITGDERAAVYRRPEDV
HAEDRPPGEAPPEGAEEGGRPRPIPEAYVWSNLTSGNGSRALWLLLLPFMVVNLAHWMRP
SSRHRSRAVRGYGMLVRLAGLTLTLLLTAAACEVALDLTAWQCAGTRACAAEHSWLGFVS
PELSGGGWWSQPGRRLALASLAPAALMGLLWFLSRRTWSAYESALPLPPDAEAKEETSAT
ALAEPGFWYGRRLVARLRAAHTAAGLLTVAAAVGTSAARFDRRDGGPVLLDVLGRVLEGA
LALGFALVLWVVCRRGRSERRADDRRDGRLVRALPAAALALLALSLLYASWSRPRWRSEG
RLPGDFTFGSLVLVQGALVVVLGVVAYVLQRRAPESRTALGGQGGPAVTMLACALGGVMS
GGVAQRVGDWLDGAGTPGQGSWIPGPPVMLTWQASGIPVLLLALLVLFAFLAVRTTRRTR
AGIPQVHRDYPDGPHDIIRTRRIAGTRARARLTDEAPLLVGVTAGFTLLLGAAALAGAWA
TGEVPAEAARGEADFVSGGAQVAQALGSWFIGLGFVLLVTSGRRAYRDASARRTIGILWD
VGTFWPRAAHPFAPPCYAERAVPDLSWRMATWTRTTGGRLVISGHSQGSVLAAAAAWQLS
PAARRRVALLTYGSPLERLYGRWFPAHFGPRTLHALHRDIDCWRNLHRETDPIGGPVRVD
AGEGPEVDRPPLRDPLAYGRTQLLPLPAPILGHSEYQADPAFAEERELLLARLRPAAVPG
PRPGTGEEGTQTSTGTSSG
selected fasta
>[integral membrane protein]
GTGGACCGTGCCACAGAAGCCGCCCCGCCCGGCCCGAGTGCCCCGGCCGAAGAACCGGCC
CTGGAACTCCTGGTGCACGGAGTCGGCGGCACCACACCGGCCGAGATGCTCGACGATCCG
CGGACCGTGCGGATCACCGGCGACGAACGAGCGGCCGTCTACCGCCGCCCCGAGGACGTG
CACGCCGAGGACCGCCCGCCGGGCGAGGCCCCGCCCGAGGGCGCCGAGGAGGGCGGGCGC
CCGCGGCCGATCCCCGAGGCCTACGTCTGGTCCAACCTCACCTCCGGCAACGGCTCCCGC
GCCCTGTGGCTGCTGCTCCTGCCGTTCATGGTGGTCAACCTCGCGCACTGGATGCGCCCC
AGCTCCCGGCACCGCAGCCGCGCCGTCCGCGGCTACGGCATGCTCGTCCGCCTCGCCGGG
CTGACCCTGACCCTGCTGCTGACCGCGGCCGCCTGCGAGGTCGCCCTCGACCTGACCGCC
TGGCAGTGCGCGGGCACCCGGGCCTGCGCCGCCGAGCACTCCTGGCTCGGCTTCGTCTCC
CCGGAGCTGTCCGGCGGGGGCTGGTGGTCCCAGCCGGGGCGGCGGCTCGCCCTCGCCTCA
CTGGCCCCGGCCGCGCTGATGGGGCTGCTCTGGTTCCTCTCCCGCCGGACCTGGAGCGCC
TACGAGTCGGCGCTCCCGCTGCCGCCCGACGCCGAGGCCAAGGAGGAGACCAGCGCCACC
GCCCTCGCCGAACCCGGCTTCTGGTACGGCAGGCGCCTGGTCGCCCGGCTGCGCGCCGCG
CACACCGCCGCCGGGCTGCTCACCGTCGCCGCCGCGGTCGGCACCTCGGCGGCCCGCTTC
GACCGGCGGGACGGCGGCCCCGTACTCCTCGACGTCCTCGGCCGGGTCCTGGAAGGCGCC
CTCGCCCTCGGCTTCGCCCTGGTGCTCTGGGTGGTCTGCCGCCGGGGCCGCAGCGAGCGC
CGGGCCGACGACCGCCGCGACGGGCGCCTGGTGCGCGCGCTGCCCGCCGCGGCGCTCGCC
CTGCTCGCCCTCTCCCTCCTCTACGCCTCCTGGTCCAGGCCCCGTTGGCGCTCCGAGGGC
CGCCTCCCCGGCGACTTCACCTTCGGCTCGCTGGTCCTGGTGCAGGGCGCGCTCGTCGTC
GTCCTCGGGGTGGTCGCCTACGTGCTCCAGCGGCGCGCGCCGGAGTCGCGCACCGCGCTC
GGCGGTCAGGGCGGCCCCGCGGTCACGATGCTCGCCTGCGCCCTCGGCGGGGTCATGTCC
GGCGGCGTCGCCCAGCGGGTCGGCGACTGGCTGGACGGCGCCGGCACCCCGGGCCAGGGC
TCCTGGATCCCGGGCCCGCCGGTCATGCTGACCTGGCAGGCCTCCGGCATACCCGTACTG
CTCCTCGCGCTCCTCGTGCTCTTCGCCTTCCTCGCGGTACGCACCACCAGGCGCACCCGC
GCGGGCATCCCCCAGGTGCACCGCGACTACCCGGACGGGCCGCACGACATCATCCGCACC
CGCCGGATCGCGGGCACCCGCGCCCGGGCCCGGCTCACCGACGAGGCGCCGCTCCTGGTC
GGGGTCACCGCGGGCTTCACCCTGCTCCTCGGGGCCGCCGCGCTCGCCGGTGCCTGGGCC
ACCGGGGAGGTGCCCGCCGAAGCGGCCCGCGGCGAGGCCGACTTCGTCTCCGGCGGCGCG
CAGGTGGCGCAGGCCCTCGGCTCCTGGTTCATCGGACTCGGCTTCGTCCTCCTGGTGACC
TCGGGGCGGCGCGCCTACCGCGATGCCTCGGCCCGCCGCACCATCGGCATCCTCTGGGAC
GTCGGCACCTTCTGGCCGCGCGCCGCGCACCCCTTCGCGCCCCCCTGCTACGCCGAGCGC
GCGGTGCCCGATCTGAGCTGGCGGATGGCCACCTGGACCCGCACCACCGGCGGGCGCCTG
GTGATCTCCGGCCACTCGCAGGGCAGTGTGCTCGCCGCCGCCGCGGCCTGGCAGCTCTCG
CCCGCCGCCCGCCGCCGGGTGGCCCTGCTCACCTACGGCTCCCCGCTGGAACGCCTCTAC
GGCCGCTGGTTCCCGGCCCACTTCGGACCGCGCACCCTGCACGCCCTGCACCGCGACATC
GACTGCTGGCGCAACCTCCACCGGGAGACCGACCCCATCGGCGGCCCGGTGCGGGTGGAC
GCGGGCGAGGGCCCCGAGGTCGACCGGCCCCCGCTGCGCGACCCGCTCGCCTACGGCCGT
ACGCAGCTGCTCCCGCTGCCCGCCCCGATCCTCGGCCACTCCGAGTACCAGGCGGACCCG
GCCTTCGCCGAGGAGCGCGAACTGCTGCTCGCCCGGCTGCGCCCCGCCGCCGTCCCCGGA
CCGCGGCCGGGCACCGGGGAGGAGGGGACTCAGACCAGTACGGGCACGTCCTCCGGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM
 [100-117]  Transmembrane (o-i) [129-151]  Transmembrane (i-o) [196-213]  Transmembrane (o-i) [257-279]  Transmembrane (i-o) [294-313]  Transmembrane (o-i) [330-352]  Transmembrane (i-o) [367-389]  Transmembrane (o-i) [402-424]  Transmembrane (i-o) [449-471]  Transmembrane (o-i) [518-540]  Transmembrane (i-o) [560-582]  Transmembrane (o-i)
Transmembrane 11