close all open/close all

CDS information : Salino_00340


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction37,747 / 35,321 / - [in whole cluster]
37,747 / 35,321 / - [in contig]
Locationcomplement(35321..37747) [in whole cluster]
complement(35321..37747) [in contig]
TypeCDS
Length2,427 bp (808 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)sporulation protein K-like protein
Gene
Gene (GenBank)spoVK
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[sporulation protein K-like protein]
MAQGTVQVTHTGTSRWRRRTGEYASLSAALEAAADGDVLTVAPGTYRENLVVQRAVTLRG
PEGGAGSVRIAPAEGVPLTVRAPATVQGLQVEGQDAAAPALLVEESTPEITDVRVVTRSA
AGIEVRGGARPTVRRCTVDNPAGVGIAVLEGAAGLFEECEVVAAGQSGIAVRGGARPRLE
RCRVHHTAGAGLSVTGEQSGVEAVGCEIYEVRGSGVQVTQRAGAQLTDCDVHRTTADGVT
LDTDAVLTLADSRIHDIPENAVDLRSRSVLTLTRSTVSRFGRNGLSVWDPGTRVDAHECE
IHESTGDYPAVWISDGAAAVLDSCRVHDVPDALFVLDRGSRADVVDSDLSQVRNTAVSVS
DGATAQLDDCRIRDAATGAWFRDHGSGGTLSGCTVDGTQTGVIVTKGADPTVERCTVSSP
AEAGFYVSADGRGTFRSCRVSGSAGYGFHVIDGCRATLHKCRTERCARGGYEFAEATGAT
AGSGPLVTECTSDESAEIRTPAAETAPLTAVQSPGLLGALPAQAPAAAEPGQPGPEPEAR
PAKDVLGELDALVGLESVKREVRALTDMIEVGRRRKEAGLKAASVRRHLVFTGSPGTGKT
TVARLYGEILASLGVLEKGHLVEVSRVDLVGEHIGSTAIRTQQAFERARGGVLFIDEAYA
LSPEDSGRDFGREAIDTLVKLMEDERDAVVVIVAGYTTEMERFLTVNPGVASRFSRVITF
GDYSPEELLSIVGQQAEEHEYRLTEGATESVLKYFAAIPKGPAFGNGRTARQTFEAMVER
HAGRVAQLAETSTDDLSLLYPEDVPVLV
selected fasta
>[sporulation protein K-like protein]
ATGGCACAGGGCACGGTCCAGGTGACGCACACCGGCACTTCGCGGTGGCGGCGCCGCACG
GGCGAGTACGCCTCGCTGTCGGCCGCCCTGGAGGCCGCCGCCGACGGAGACGTCCTCACC
GTCGCCCCCGGCACCTATCGCGAGAATCTGGTCGTCCAGCGCGCGGTCACCCTGCGCGGC
CCCGAGGGCGGCGCGGGCTCGGTGCGGATCGCGCCGGCCGAGGGGGTCCCGCTGACCGTG
CGCGCCCCGGCGACCGTGCAGGGCCTCCAGGTCGAGGGCCAGGACGCCGCGGCGCCCGCC
CTGCTCGTCGAGGAGAGCACCCCGGAGATCACCGACGTCCGGGTGGTCACCCGCTCCGCC
GCCGGGATCGAGGTGCGCGGCGGCGCCCGCCCGACGGTCCGGCGCTGCACCGTGGACAAT
CCGGCGGGCGTCGGCATCGCCGTCCTGGAGGGCGCGGCGGGCCTCTTCGAGGAGTGCGAA
GTCGTCGCCGCGGGGCAGTCCGGGATCGCGGTGCGCGGCGGCGCCCGTCCGCGCCTCGAG
CGGTGCCGGGTCCACCACACCGCGGGGGCCGGGCTCTCGGTGACCGGCGAGCAGTCCGGC
GTCGAGGCGGTGGGCTGCGAGATCTACGAGGTGCGCGGCTCGGGCGTGCAGGTCACCCAG
CGGGCCGGCGCCCAGCTCACCGACTGCGATGTGCACCGCACCACCGCCGACGGCGTCACC
CTCGACACCGACGCGGTGCTCACCCTCGCCGACAGCCGCATCCACGACATCCCCGAGAAC
GCCGTGGACCTGCGCTCCCGCTCGGTGCTCACCCTGACCCGCTCCACCGTCTCCCGCTTC
GGCCGCAACGGCCTCTCCGTCTGGGACCCGGGCACCCGGGTGGACGCCCACGAGTGCGAG
ATCCACGAGAGCACCGGCGACTATCCGGCGGTCTGGATCAGCGACGGCGCCGCCGCCGTC
CTCGACTCCTGCCGGGTGCACGACGTGCCCGACGCCCTCTTCGTCCTGGACCGCGGCTCC
CGCGCGGACGTGGTCGACAGCGACCTCTCCCAGGTCCGCAACACCGCCGTCTCGGTGAGC
GACGGCGCCACCGCCCAGCTCGACGACTGCCGGATCCGGGACGCGGCCACCGGCGCCTGG
TTCCGCGACCACGGCAGCGGCGGCACCCTCTCCGGCTGCACCGTCGACGGCACCCAGACC
GGGGTCATCGTCACCAAGGGCGCCGACCCCACGGTGGAGCGCTGCACCGTCTCCTCCCCC
GCCGAGGCCGGTTTCTACGTCTCGGCGGACGGCCGGGGCACCTTCCGCTCCTGCCGTGTC
TCGGGCAGCGCCGGCTACGGCTTCCATGTCATAGACGGCTGCCGGGCCACCCTGCACAAG
TGCCGTACGGAGCGCTGCGCGCGCGGCGGTTACGAGTTCGCGGAAGCCACCGGCGCGACG
GCCGGTTCGGGCCCGCTGGTCACCGAGTGCACCAGCGACGAGAGCGCCGAGATACGGACA
CCGGCCGCGGAGACCGCCCCGCTGACCGCGGTGCAGTCGCCGGGGCTCCTCGGGGCGCTG
CCGGCCCAGGCCCCGGCCGCCGCCGAGCCCGGTCAGCCGGGCCCGGAGCCGGAGGCCCGT
CCCGCCAAGGACGTCCTCGGCGAACTCGACGCCCTGGTGGGCCTGGAGAGCGTCAAGCGG
GAGGTGCGGGCGCTCACCGACATGATCGAGGTCGGGCGCCGCCGCAAGGAGGCCGGGCTC
AAGGCCGCCTCGGTCCGCCGCCATCTCGTCTTCACCGGCTCCCCCGGCACCGGCAAGACC
ACGGTCGCGCGGCTGTACGGCGAGATCCTCGCCTCCCTCGGCGTCCTGGAGAAGGGGCAC
CTGGTCGAGGTCTCCCGGGTCGACCTGGTCGGCGAGCACATCGGCTCCACCGCCATCCGC
ACCCAGCAGGCCTTCGAACGCGCCCGCGGCGGTGTGCTGTTCATCGACGAGGCCTACGCC
CTCTCCCCCGAGGACTCGGGCCGCGACTTCGGCCGGGAGGCCATCGACACCCTGGTCAAG
CTGATGGAGGACGAGCGGGACGCGGTCGTGGTGATCGTCGCGGGCTACACCACCGAGATG
GAGCGCTTCCTCACCGTCAACCCCGGTGTGGCCTCCCGGTTCTCCCGGGTCATCACCTTC
GGCGACTACAGCCCCGAGGAACTCCTCAGCATCGTCGGGCAGCAGGCCGAGGAGCACGAG
TACCGGCTCACCGAGGGCGCCACGGAGTCGGTGCTCAAGTACTTCGCGGCGATCCCCAAG
GGCCCCGCCTTCGGCAACGGGCGCACCGCCCGCCAGACCTTCGAGGCGATGGTCGAGCGG
CACGCGGGCCGGGTCGCCCAGCTCGCCGAGACGAGCACCGACGACCTCAGCCTGCTCTAC
CCGGAGGACGTGCCCGTACTGGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000641 CbxX/CfqX (Family)
 [548-562]  1.3000049540733e-48 PR00819 [588-603]  1.3000049540733e-48 PR00819 [626-640]  1.3000049540733e-48 PR00819 [640-659]  1.3000049540733e-48 PR00819 [671-683]  1.3000049540733e-48 PR00819 [692-709]  1.3000049540733e-48 PR00819 [709-728]  1.3000049540733e-48 PR00819 [766-778]  1.3000049540733e-48 PR00819
PR00819   CBXCFQXSUPER
IPR003593 AAA+ ATPase domain (Domain)
 [585-724]  5.69999708783953e-10 SM00382
SM00382   AAA
IPR003959 ATPase, AAA-type, core (Domain)
 [590-720]  3.7e-17 PF00004
PF00004   AAA
IPR006626 Parallel beta-helix repeat (Repeat)
 [105-127]  23.9999995789644 SM00710 [128-150]  0.129999995835436 SM00710 [151-173]  5.39999977351167 SM00710 [174-196]  0.109999999702296 SM00710 [198-220]  6.99999965558827 SM00710 [221-243]  1.59999999145027 SM00710 [267-289]  6.50000002347785 SM00710 [339-361]  20.0000020319537 SM00710 [362-383]  6.09999977126211 SM00710 [385-406]  0.239999995789644 SM00710 [407-429]  0.0729999989782891 SM00710 [430-452]  0.299999985646004 SM00710 [453-475]  27.0000035356386 SM00710
SM00710   PbH1
IPR006633 Carbohydrate-binding/sugar hydrolysis domain (Domain)
 [41-172]  3.0999994589937e-05 SM00722 [313-474]  6.00000361638163e-10 SM00722
SM00722   CASH
IPR011050 Pectin lyase fold/virulence factor (Domain)
 [20-242]  1.99999636034521e-31 SSF51126 [310-474]  1.49999977583352e-14 SSF51126
SSF51126   Pectin_lyas_like
IPR012334 Pectin lyase fold (Domain)
 [19-176]  6.90000000000001e-32 G3DSA:2.160.20.10 [187-306]  6.90000000000001e-32 G3DSA:2.160.20.10 [345-454]  4.80000000000001e-13 G3DSA:2.160.20.10
G3DSA:2.160.20.10   Pectin_lyas_fold
SignalP No significant hit
TMHMM No significant hit