close all open/close all

CDS information : Salino_00350


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction38,464 / 37,859 / - [in whole cluster]
38,464 / 37,859 / - [in contig]
Locationcomplement(37859..38464) [in whole cluster]
complement(37859..38464) [in contig]
TypeCDS
Length606 bp (201 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[hypothetical protein]
MRTIRGLWRWRGNPLWRRTDRIEGWAALATLLCVLLGAPLVGVVSGTLCHQALLDAAREQ
RAQRKAVTAVVIRPVRPASFDTDPETAPVREGLSRAVAKWTAPDGTSHTGAVKTYLRTPR
TGDRFRIWTDKQGRPVTRPMNRAAAATHSVLAGFGGALATAGAAEGTRQLVMWRLVRRRH
AEWDRAWDKAGPDWGRTGTGS
selected fasta
>[hypothetical protein]
TTGCGGACGATCCGCGGACTGTGGCGCTGGCGGGGCAATCCGCTCTGGCGCCGGACCGAT
CGCATCGAGGGCTGGGCCGCCCTCGCGACACTGCTCTGCGTCCTCCTGGGCGCACCGCTC
GTCGGCGTGGTCAGCGGCACCCTGTGCCATCAGGCGCTGCTCGACGCGGCCCGCGAACAG
CGCGCCCAGCGCAAGGCGGTGACCGCCGTCGTGATCCGCCCGGTCCGCCCGGCCTCCTTC
GACACCGACCCCGAAACCGCCCCGGTACGCGAGGGGTTAAGCCGCGCCGTCGCCAAGTGG
ACGGCGCCGGACGGGACTTCGCACACCGGCGCGGTCAAGACGTACTTGCGCACCCCGAGG
ACGGGCGACCGCTTCCGGATATGGACCGACAAGCAGGGCAGGCCGGTCACCCGCCCGATG
AACCGGGCCGCGGCGGCCACCCACTCCGTGCTCGCCGGATTCGGTGGCGCCCTGGCCACC
GCGGGGGCGGCCGAGGGCACCCGGCAGCTGGTCATGTGGCGTCTGGTGCGGCGCCGGCAC
GCGGAGTGGGACCGCGCCTGGGACAAAGCGGGGCCGGACTGGGGCAGGACGGGCACCGGC
AGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-46]  0.586 Signal
Eukaryota   
 [1-42]  0.804 Signal
Bacteria, Gram-negative   
 [1-45]  0.672 Signal
Bacteria, Gram-positive   
TMHMM
 [21-43]  Transmembrane (i-o)
Transmembrane 1