close all open/close all

CDS information : Salino_00360


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction39,280 / 38,825 / - [in whole cluster]
39,280 / 38,825 / - [in contig]
Locationcomplement(38825..39280) [in whole cluster]
complement(38825..39280) [in contig]
TypeCDS
Length456 bp (151 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[hypothetical protein]
MTSPRSTYGGGYYSAPSFPDTPIYDSLVAERGTPQIAPIRVPAAYESSSHLPALPSALPA
LPSAPQQPQYGYPPAQHAGLQQAPAPYIPQQVPPRGYQAQQAPQRPMATGTGYEAMRPAA
PRPAAPRPAAPRQAPGPYEDPYQRQQQYRAY
selected fasta
>[hypothetical protein]
ATGACCTCCCCCCGCTCCACATATGGCGGCGGTTACTACTCCGCGCCGTCCTTCCCGGAC
ACTCCGATCTACGACTCCCTGGTCGCCGAGCGGGGCACACCCCAGATCGCTCCGATCCGG
GTCCCCGCCGCGTACGAGAGCAGCAGTCATCTGCCCGCTCTCCCGTCGGCGCTTCCCGCG
CTGCCCTCGGCGCCGCAGCAGCCGCAGTACGGCTATCCGCCGGCGCAGCACGCCGGGCTG
CAGCAGGCCCCGGCGCCGTACATCCCGCAGCAGGTGCCGCCCCGCGGCTACCAGGCGCAG
CAGGCCCCGCAGCGGCCGATGGCGACCGGCACGGGCTACGAGGCCATGCGCCCTGCGGCG
CCTCGGCCCGCCGCCCCGCGCCCCGCGGCGCCGCGCCAGGCTCCCGGGCCGTACGAGGAC
CCGTACCAGAGACAGCAGCAGTACCGGGCGTACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit