close all open/close all

CDS information : Salino_00380


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction40,969 / 39,740 / - [in whole cluster]
40,969 / 39,740 / - [in contig]
Locationcomplement(39740..40969) [in whole cluster]
complement(39740..40969) [in contig]
TypeCDS
Length1,230 bp (409 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)glycosyl transferase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[glycosyl transferase]
MSALLWICAFSLLAWLWLLLCQGYFWRTDVRLPPGAEPARWPSVAVVVPARDEAAVLPRS
LPSLLAQEYPGPARIFLVDDNSTDGTGELAAELGRAPGALPLTVLSAPEPAAGWTGKLWA
VRHGIERARDTDPAYLLLTDADIAHEPDSLRALVAAAEGGGYDLVSLMARLRVDSAWERL
IVPAFVYFFGQLYPFRWVNRRGGRTAAAAGGCVLLRTAAAERARIPESIRGAVIDDVSLA
REVKRGGGHIWLGLAERVDSVRPYPRLADLWRMVARSAYAQLRHQPLILLGTVLGLALVY
LAPPAGLLTGLVRGEGALALTGGATWLLMAGSYAPMLRHYRQTLWLAPLLPLVAALYLLM
TVDSAVQHYRGRGAAWKGRTYPKPAAGPAVDGSAHTSDERIPRAAPEQP
selected fasta
>[glycosyl transferase]
GTGAGCGCCCTCCTGTGGATCTGTGCTTTCTCGCTGCTCGCCTGGCTCTGGCTGCTGCTG
TGCCAGGGCTACTTCTGGCGTACGGATGTCCGGCTGCCCCCCGGCGCCGAACCCGCGCGC
TGGCCTTCCGTGGCGGTGGTGGTGCCGGCCCGCGACGAGGCGGCCGTGCTGCCCCGGAGC
CTTCCCTCGCTGCTGGCCCAGGAGTATCCGGGTCCGGCGCGGATCTTCCTCGTCGACGAC
AACAGCACCGACGGTACCGGGGAGTTGGCCGCGGAGCTGGGGCGTGCGCCGGGCGCGCTC
CCCCTGACGGTGCTCAGCGCGCCGGAGCCCGCGGCGGGCTGGACCGGGAAGCTGTGGGCG
GTACGGCACGGGATCGAACGGGCGCGTGACACGGACCCCGCGTACCTGCTCCTGACCGAC
GCGGACATCGCGCACGAGCCCGACAGCCTGCGCGCGCTGGTGGCGGCGGCCGAGGGCGGC
GGCTACGACCTGGTCTCGCTGATGGCGCGGCTGCGGGTGGACAGCGCCTGGGAGCGGCTG
ATCGTGCCCGCCTTCGTCTACTTCTTCGGGCAGCTCTACCCGTTCCGGTGGGTCAACCGG
CGGGGCGGGCGCACCGCGGCGGCGGCCGGGGGCTGCGTGCTGCTGCGCACCGCGGCTGCG
GAGCGGGCGCGGATCCCGGAGTCCATCCGGGGCGCCGTCATCGACGATGTCTCGCTGGCC
CGGGAGGTGAAACGCGGCGGCGGGCACATCTGGCTGGGCCTCGCCGAGCGGGTGGACAGC
GTCCGCCCCTATCCGCGCCTCGCCGACCTCTGGCGGATGGTGGCACGCAGTGCCTACGCC
CAGCTGCGGCACCAGCCGCTGATCCTGCTCGGCACCGTGCTCGGCCTCGCCCTAGTCTAT
CTCGCCCCGCCCGCCGGGCTGTTGACAGGGCTGGTCCGCGGCGAGGGCGCCCTGGCGCTC
ACCGGCGGCGCGACCTGGCTGCTGATGGCGGGGAGTTACGCCCCGATGCTGCGCCACTAC
CGGCAGACGCTCTGGCTGGCGCCGCTGCTGCCCCTGGTGGCGGCGCTGTACCTGCTGATG
ACGGTGGACTCGGCGGTGCAGCACTACCGGGGACGCGGCGCCGCCTGGAAGGGCCGGACC
TACCCGAAGCCCGCCGCCGGGCCCGCGGTCGACGGCAGCGCGCACACCTCGGACGAGCGG
ATCCCCCGGGCGGCTCCCGAACAGCCTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR017832 Glycosyl transferase, family 2, hopene-associated, HpnB (Family)
 [6-382]  TIGR03469
TIGR03469   HpnB
SignalP
 [1-23]  0.998 Signal
Eukaryota   
 [1-27]  0.486 Signal
Bacteria, Gram-negative   
TMHMM
 [4-26]  Transmembrane (o-i) [286-308]  Transmembrane (i-o) [318-337]  Transmembrane (o-i) [344-366]  Transmembrane (i-o)
Transmembrane 4