close all open/close all

CDS information : Salino_00390


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction41,027 / 41,812 / + [in whole cluster]
41,027 / 41,812 / + [in contig]
Location41027..41812 [in whole cluster]
41027..41812 [in contig]
TypeCDS
Length786 bp (261 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)glutamate racemase
Gene
Gene (GenBank)murI
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[glutamate racemase]
MKIALVDSGIGLLAAAAAVRRLRPDADLLLSCDPPGMPWGPRAPEDIAARALAAAEAAAG
YGPGALIVACNTATVHGLPVLRSRFEPGLPVVGTVPAIKPAAAGGGPVAIWATPGTTGSP
YQRDLIARFAGSAEVTEVPCPGLADAVEHADERAIDGAIAAAAALTPPEVTTVVLGCTHY
ELVAERIRAALQQPGLPPLVLHGSAGAVAAQALRRLGEHPAPEAPATGGLTVLLSGREGG
LPEPAKAYADGRLLTAASAAR
selected fasta
>[glutamate racemase]
GTGAAGATCGCGCTCGTGGACTCCGGTATCGGACTGCTCGCCGCCGCGGCCGCGGTGCGC
CGCCTGCGCCCGGACGCCGACCTCCTGCTCTCCTGCGACCCGCCGGGCATGCCGTGGGGG
CCCCGCGCGCCCGAGGACATCGCGGCGCGCGCGCTGGCCGCCGCGGAGGCCGCCGCCGGG
TACGGACCCGGGGCCCTGATCGTCGCCTGCAACACCGCCACGGTGCACGGCCTGCCCGTC
CTGCGCTCCCGCTTCGAGCCGGGGCTGCCGGTCGTCGGCACGGTTCCGGCGATCAAGCCC
GCCGCGGCGGGCGGCGGCCCGGTCGCCATCTGGGCCACGCCGGGCACCACCGGGAGCCCC
TACCAGCGCGACCTGATCGCGCGGTTCGCGGGCTCCGCCGAGGTCACCGAGGTGCCCTGC
CCCGGCCTCGCGGACGCCGTCGAGCACGCCGACGAGCGGGCGATCGACGGGGCGATCGCC
GCCGCCGCGGCCCTCACCCCGCCCGAGGTGACCACCGTCGTCCTCGGCTGCACCCACTAC
GAGCTGGTCGCCGAGCGGATCCGCGCAGCCCTCCAGCAGCCCGGACTCCCGCCGCTGGTG
CTGCACGGCTCCGCGGGCGCCGTCGCCGCCCAGGCCCTGCGGCGCCTCGGCGAGCACCCC
GCCCCGGAGGCGCCCGCCACCGGCGGCCTCACCGTGCTCCTGAGCGGGCGCGAGGGCGGA
CTCCCCGAGCCCGCGAAGGCCTACGCGGACGGCAGGCTGCTCACCGCGGCGAGCGCCGCG
CGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001920 Asp/Glu racemase (Family)
 [1-106]  1.50000306971104e-24 SSF53681 [105-253]  9.30000048475975e-19 SSF53681
SSF53681   Asp/Glu_race
 [1-141]  3.2e-33 G3DSA:3.40.50.1860
G3DSA:3.40.50.1860   Asp/Glu_race
IPR015942 Asp/Glu/hydantoin racemase (Family)
 [4-197]  1.6e-20 PF01177
PF01177   Asp_Glu_race
IPR018187 Asp/Glu racemase, active site (Active_site)
 [67-75]  PS00923
PS00923   ASP_GLU_RACEMASE_1
SignalP
 [1-18]  0.728 Signal
Eukaryota   
TMHMM No significant hit