close all open/close all

CDS information : Salino_00410


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction42,644 / 44,254 / + [in whole cluster]
42,644 / 44,254 / + [in contig]
Location42644..44254 [in whole cluster]
42644..44254 [in contig]
TypeCDS
Length1,611 bp (536 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)polyprenol-phosphate-mannosyl transferase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[polyprenol-phosphate-mannosyl transferase]
MTATATTADDAERLDPPPAAASRRVRLLRRLVRPLTAALAGVLLYLSFPPRTVWWLALPA
FAALAWCLRGRRARAGFGLGYLFGLGFLLPLLVWTGVEVGPVPWLALAAIEALFVGAAGA
GIAVVSRLPGAPLWSAGVWILTEAARARAPFGGFPWGKVAFGQADGVFLPLAALGGTPVL
GFAVVLTGFGLYEAVRLLVAARAGRPPRRTLAALALGALLLPLLAALGSCALVSDEAEDG
TTTVALIQGNVPRAGLDFNAQRRAVLDYHARETRRLADRISPGEVDLVLWPENSSDIDPF
TNGDARAVIEDAVRAVGAPVSIGAVVEDGDRLYNQQVLWDPRKGPVDRYNKRQVQPFGEY
IPLRSLISVFSSDVDMVRQDFSRGSRPGVFRMANARVGLATCYEAAFDWAVRDAVEDGAQ
MISVPSNNATFGHSEMTYQQLAMSRIRAVEHSRTVAVPVTSGVSAVIMPDGRIVEKTKMF
TAESLVEEVPLRSSRTPATRLGALPEGLLVLVGAGGLGRALAPAARRRFARRGRPA
selected fasta
>[polyprenol-phosphate-mannosyl transferase]
GTGACCGCCACCGCCACCACCGCAGACGACGCGGAACGTCTCGATCCGCCCCCGGCCGCC
GCCTCGCGCCGGGTGCGTCTGCTGCGCCGCCTGGTCCGGCCGCTGACCGCGGCCCTCGCC
GGTGTCCTGCTCTACCTGAGTTTCCCGCCGCGCACGGTCTGGTGGCTGGCGCTGCCCGCC
TTCGCCGCCCTGGCCTGGTGCCTGCGCGGCCGCCGGGCCCGGGCCGGTTTCGGGCTCGGC
TACCTCTTCGGGCTCGGCTTCCTGCTGCCCCTCCTGGTGTGGACCGGCGTCGAGGTCGGC
CCCGTGCCCTGGCTCGCCCTCGCCGCGATCGAGGCCCTCTTCGTCGGCGCGGCCGGTGCC
GGGATCGCGGTGGTCTCCCGGCTGCCGGGGGCGCCCCTGTGGTCCGCGGGCGTGTGGATC
CTGACCGAGGCCGCGCGCGCCCGGGCCCCCTTCGGCGGCTTCCCCTGGGGCAAGGTCGCC
TTCGGCCAGGCGGACGGGGTCTTCCTGCCGCTGGCCGCGCTCGGCGGTACGCCCGTACTC
GGCTTCGCGGTGGTCCTCACCGGCTTCGGCCTGTACGAGGCGGTCCGGCTCCTGGTGGCG
GCGCGGGCCGGACGCCCCCCGCGGCGGACGCTCGCCGCGCTCGCCCTCGGCGCCCTGCTG
CTGCCGCTGCTCGCCGCCCTCGGCTCCTGCGCCCTGGTCAGCGACGAGGCGGAGGACGGC
ACCACCACGGTGGCGCTCATCCAGGGCAATGTGCCGCGCGCGGGTCTGGACTTCAACGCC
CAGCGCCGGGCCGTGCTCGACTACCACGCCCGCGAGACGCGGCGGCTCGCCGACCGGATC
TCCCCGGGCGAGGTGGACCTCGTCCTGTGGCCGGAGAACTCCTCCGACATCGACCCCTTC
ACCAACGGCGACGCCCGCGCGGTCATCGAGGACGCGGTACGGGCCGTCGGGGCGCCCGTC
TCCATCGGCGCGGTGGTGGAGGACGGGGACAGGCTCTACAACCAGCAGGTGCTGTGGGAC
CCGCGCAAGGGCCCGGTCGACCGCTACAACAAGCGGCAGGTCCAGCCCTTCGGCGAGTAC
ATCCCGCTGCGGTCCCTGATCAGCGTCTTCAGCTCCGATGTGGACATGGTCCGCCAGGAC
TTCAGCCGGGGGAGCCGGCCCGGTGTGTTCCGGATGGCGAACGCCCGGGTCGGTCTCGCC
ACCTGCTACGAGGCGGCCTTCGACTGGGCGGTGCGCGACGCCGTCGAGGACGGGGCCCAG
ATGATCTCCGTACCGAGCAACAACGCCACCTTCGGGCACAGCGAGATGACCTACCAGCAG
CTGGCGATGTCCCGGATCCGGGCCGTCGAGCACAGCAGGACCGTCGCGGTGCCGGTCACC
AGCGGGGTCAGCGCGGTGATCATGCCGGACGGGCGGATCGTCGAGAAGACGAAGATGTTC
ACCGCCGAGTCGCTCGTCGAGGAGGTGCCGCTGCGCTCCTCCCGGACCCCGGCCACCCGG
CTCGGCGCCCTTCCCGAGGGCCTGCTCGTCCTGGTCGGCGCGGGCGGGCTCGGCCGGGCG
CTGGCCCCCGCGGCGCGGCGCCGGTTCGCGCGCCGGGGACGTCCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003010 Carbon-nitrogen hydrolase (Domain)
 [239-503]  9.8e-33 G3DSA:3.60.110.10
G3DSA:3.60.110.10   Ntlse/CNhydtse
 [242-536]  PS50263
PS50263   CN_HYDROLASE
 [233-505]  2.50000909916183e-44 SSF56317
SSF56317   Ntlse/CNhydtse
 [244-427]  1.6e-15 PF00795
PF00795   CN_hydrolase
IPR004563 Apolipoprotein N-acyltransferase (Family)
 [83-473]  3.10000000000005e-81 TIGR00546
TIGR00546   Lnt
SignalP
 [1-37]  0.389 Signal
Bacteria, Gram-positive   
 [1-1]  Signal-anchor
Eukaryota   
 [1-37]  0.273 Signal
Bacteria, Gram-negative   
TMHMM
 [31-48]  Transmembrane (i-o) [53-70]  Transmembrane (o-i) [77-94]  Transmembrane (i-o) [104-126]  Transmembrane (o-i) [133-152]  Transmembrane (i-o) [167-189]  Transmembrane (o-i) [210-232]  Transmembrane (i-o)
Transmembrane 7