close all open/close all

CDS information : Salino_00420


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction44,283 / 44,756 / + [in whole cluster]
44,283 / 44,756 / + [in contig]
Location44283..44756 [in whole cluster]
44283..44756 [in contig]
TypeCDS
Length474 bp (157 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)mut-like protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[mut-like protein]
MATPEFISTLRASAGHQLLWLPGVTAIVFDDAGRVLLGRRSDNGRWSVIGGIPDPGEQPA
ACAVREVYEETAVRCVPERVVLVEAGQPVQYENSDICQFMDITFRCRAVGGEARVNDDES
LEVGWFEVDALPRIHETGLRRIKQALAEEPTWFPPVA
selected fasta
>[mut-like protein]
ATGGCTACACCTGAGTTCATCAGCACCCTGCGCGCGAGCGCCGGGCACCAGCTCCTGTGG
CTGCCGGGGGTGACCGCCATCGTCTTCGACGACGCGGGCCGGGTGCTCCTCGGCCGCCGG
TCCGACAACGGCCGGTGGTCGGTCATCGGCGGCATCCCCGACCCCGGCGAGCAGCCCGCG
GCCTGCGCGGTGCGCGAGGTCTACGAGGAGACCGCGGTGCGCTGCGTGCCGGAGCGGGTC
GTCCTCGTCGAGGCCGGGCAGCCCGTCCAGTACGAGAACAGCGACATCTGCCAGTTCATG
GACATCACCTTCCGCTGCCGCGCGGTCGGCGGCGAGGCGCGGGTCAACGACGACGAGTCG
CTGGAGGTCGGCTGGTTCGAGGTCGACGCCCTGCCCCGGATCCACGAGACCGGCCTGCGC
CGCATCAAGCAGGCGCTCGCCGAGGAGCCGACCTGGTTCCCGCCGGTGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000086 NUDIX hydrolase domain (Domain)
 [21-138]  2.1e-20 PF00293
PF00293   NUDIX
 [14-148]  2.7e-28 G3DSA:3.90.79.10
G3DSA:3.90.79.10   NUDIX_hydrolase
 [19-147]  PS51462
PS51462   NUDIX
IPR015797 NUDIX hydrolase domain-like (Domain)
 [4-154]  4.80000830876748e-29 SSF55811
SSF55811   NUDIX_hydrolase
SignalP
 [1-26]  0.641 Signal
Eukaryota   
TMHMM No significant hit