close all open/close all

CDS information : Salino_00430


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction44,860 / 45,888 / + [in whole cluster]
44,860 / 45,888 / + [in contig]
Location44860..45888 [in whole cluster]
44860..45888 [in contig]
TypeCDS
Length1,029 bp (342 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)glutathione transferase
Gene
Gene (GenBank)
EC number2.5.1.18
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[glutathione transferase]
MSGTAGIDGGNATYGKKPFKRSRSHFTDRVTADGRDGWPVEPGRYRLVVSKACPWASRAL
VSRRLLGLEGALSLAVADPIQDHRSWRFTLDPDDRDPVLGIRYLHEAYDARETDYPGGVS
VPAVVEVPSGRLVTNDFQQITLDLATEWTALHREGAPELYPSALREEIDEVAEDVYRDVN
NGVYRCGFAHEQKTYEDACRALFARLDALSERLANRRYLVGDQITEADIRLFTTLVRFDA
VYHGHFKCNVRKIAEDPVLWAYVRDLYQTPGFGDTVDFDHIKRHYYQVHTGINPTGIVPL
GPDLSGWLTPHHREQLGGRPFGEGTPPGPPPAAERVPAAGRP
selected fasta
>[glutathione transferase]
ATGAGCGGCACGGCCGGGATCGACGGCGGCAACGCCACCTACGGCAAGAAGCCCTTCAAG
CGCTCGCGCAGCCACTTCACGGACCGGGTGACCGCCGACGGGCGCGACGGCTGGCCCGTC
GAGCCCGGGCGCTACCGGCTCGTGGTGAGCAAGGCCTGTCCCTGGGCGAGCCGGGCCCTG
GTCTCGCGCCGGCTGCTCGGCCTGGAGGGCGCCCTCTCGCTCGCGGTGGCCGATCCGATC
CAGGACCACCGCAGCTGGCGCTTCACCCTCGACCCCGACGACCGCGACCCGGTGCTCGGC
ATCCGCTACCTGCACGAGGCCTACGACGCCCGGGAGACCGACTACCCGGGCGGGGTGAGC
GTGCCCGCCGTGGTCGAGGTGCCGAGCGGCAGGCTGGTCACCAACGACTTCCAGCAGATC
ACCCTGGACCTCGCCACCGAGTGGACCGCCCTGCACCGCGAGGGCGCCCCCGAGCTGTAC
CCGTCCGCCCTGCGCGAGGAGATCGACGAGGTCGCCGAGGACGTCTACCGGGATGTGAAC
AACGGCGTCTACCGGTGCGGCTTCGCCCACGAGCAGAAGACCTACGAGGACGCCTGCCGG
GCCCTGTTCGCCCGCCTCGACGCGCTCTCCGAGCGGCTCGCGAACCGCCGCTACCTGGTG
GGGGACCAGATCACCGAGGCCGACATCCGGCTTTTCACCACCCTGGTCCGCTTCGACGCC
GTGTACCACGGCCACTTCAAGTGCAATGTGCGCAAGATCGCCGAGGACCCGGTGCTCTGG
GCCTATGTACGCGACCTCTACCAGACCCCCGGCTTCGGGGACACGGTCGACTTCGACCAC
ATCAAGCGGCACTACTACCAGGTGCACACCGGCATCAACCCGACCGGCATCGTGCCGCTC
GGCCCCGACCTCTCCGGCTGGCTGACCCCGCACCACCGCGAACAGCTCGGCGGGCGCCCC
TTCGGCGAGGGGACACCGCCCGGGCCGCCGCCCGCGGCGGAGCGCGTCCCGGCGGCCGGG
CGGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR010987 Glutathione S-transferase, C-terminal-like (Domain)
 [160-338]  1.90000694315261e-35 SSF47616
SSF47616   GST_C_like
 [162-277]  1.99999999999999e-22 G3DSA:1.20.1050.10
G3DSA:1.20.1050.10   GST_C_like
IPR012336 Thioredoxin-like fold (Domain)
 [26-152]  5.99999702863249e-08 SSF52833
SSF52833   Thiordxn-like_fd
 [31-161]  4.00000000000001e-09 G3DSA:3.40.30.10
G3DSA:3.40.30.10   Thioredoxin_fold
IPR016639 Glutathione S-transferase, predicted (Family)
 [1-314]  PIRSF015753
PIRSF015753   GST
IPR017933 Glutathione S-transferase/chloride channel, C-terminal (Domain)
 [158-288]  PS50405
PS50405   GST_CTER
SignalP No significant hit
TMHMM No significant hit