close all open/close all

CDS information : Salino_00440


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction46,031 / 46,432 / + [in whole cluster]
46,031 / 46,432 / + [in contig]
Location46031..46432 [in whole cluster]
46031..46432 [in contig]
TypeCDS
Length402 bp (133 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)glyoxalase/bleomycin resistance protein/dioxygenase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[glyoxalase/bleomycin resistance protein/dioxygenase]
MSAELNHLIVHARDNRESADFLARILGLETGPEWGPFIPLTTANGVTLDFATVPAESIVL
QHYAFLISEEEFDAALARIEGGGTAYFADPHREQPGEINRNDGGRGLYFMDPAGHGMEIL
TRPYGSHPDPDGD
selected fasta
>[glyoxalase/bleomycin resistance protein/dioxygenase]
GTGTCAGCAGAGCTCAACCACCTCATCGTCCACGCCCGTGACAACCGGGAGTCGGCGGAC
TTCCTCGCCCGCATCCTCGGTCTGGAGACCGGCCCCGAGTGGGGCCCCTTCATCCCCCTC
ACCACCGCCAACGGCGTCACCCTCGACTTCGCCACCGTCCCCGCGGAGTCGATCGTCCTC
CAGCACTACGCCTTCCTGATCTCCGAGGAGGAGTTCGACGCCGCCCTCGCCCGGATCGAG
GGCGGCGGCACCGCCTACTTCGCCGATCCGCACCGCGAGCAGCCGGGCGAGATCAACCGC
AACGACGGCGGCCGGGGCCTGTACTTCATGGACCCGGCAGGCCACGGCATGGAGATCCTC
ACCCGCCCGTACGGCAGCCACCCGGATCCGGACGGCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR025870 Glyoxalase-like domain (Domain)
 [11-119]  8.3e-10 PF12681
PF12681   Glyoxalase_2
SignalP No significant hit
TMHMM No significant hit