close all open/close all

CDS information : Salino_00450


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction48,102 / 46,567 / - [in whole cluster]
48,102 / 46,567 / - [in contig]
Locationcomplement(46567..48102) [in whole cluster]
complement(46567..48102) [in contig]
TypeCDS
Length1,536 bp (511 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)AMP-dependent synthetase and ligase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[AMP-dependent synthetase and ligase]
MIVPFAVRDFLDRATTVYGDRVGAVDEPQQPARPWEGLSYRRIGELARAQAAGLDALGVP
HGARVAVVSPNSARLLTSFYGVSGYGRVLVPVNFRLTAEEVRYIVEDSGAEVLLIDPELT
ERLAGVECRHTFTLGEETDARLYDFATGPKLPEPDENATATLNYTSGTTARPKGVQITHR
NIWVNATTFALHAGVSDRDVYLHTLPMFHANGWGMPFAMAALGVPQIVLRKVDGAEILRR
VAAHGVTVMCAAPAVVNAVLAAAQSWEGEIPGRDRVRIIVAGAPPPTRTVARVEAELGWE
FLQIYGLTETSPLLTVNRGRAEWDALPPEERAGKLVRAGAPALGVSLRTSEQGEVLARSN
VVLEGYWRQPEASAEALRDGWFHTGDGGTLDEEGYLTISDRQKDVIITGGENVSSVEVED
ALFSHPAVEEVAVIGVPDEKWGETIKALVVRAPDTEVDEAELIRHCKDRLAGYKAPTSVE
FRDTLARTATGKLQKFKLREPYWQGRERGVN
selected fasta
>[AMP-dependent synthetase and ligase]
ATGATCGTCCCGTTCGCAGTGCGCGACTTCCTCGACCGTGCCACCACCGTCTACGGCGAC
CGGGTGGGCGCCGTGGACGAGCCGCAGCAGCCGGCCCGCCCCTGGGAAGGGCTCAGCTAC
CGCAGGATCGGCGAACTCGCCCGCGCCCAGGCGGCCGGCCTGGACGCGCTCGGCGTCCCG
CACGGCGCCCGGGTCGCCGTGGTCTCCCCCAACAGCGCCCGGCTGCTCACCTCCTTCTAC
GGGGTGAGCGGGTACGGGCGGGTCCTCGTCCCGGTGAACTTCCGGCTGACCGCCGAGGAG
GTGCGCTACATCGTCGAGGACTCCGGGGCCGAAGTGCTCCTGATCGACCCGGAGTTGACC
GAGCGGCTCGCCGGGGTGGAGTGCCGGCACACCTTCACCCTCGGCGAGGAGACCGACGCC
CGCCTGTACGACTTCGCCACCGGGCCGAAGCTGCCGGAGCCGGACGAGAACGCCACCGCC
ACCCTCAACTACACCAGCGGCACCACGGCCCGGCCCAAGGGCGTCCAGATCACCCACCGC
AACATCTGGGTCAACGCGACCACCTTCGCCTTGCACGCCGGGGTGAGCGACCGGGACGTC
TATCTGCACACCCTGCCGATGTTCCACGCCAACGGCTGGGGCATGCCCTTCGCGATGGCC
GCGCTCGGCGTCCCGCAGATCGTGCTGCGCAAGGTCGACGGCGCCGAGATCCTGCGCCGG
GTCGCCGCCCACGGGGTGACCGTGATGTGCGCGGCCCCGGCCGTGGTCAACGCCGTGCTC
GCCGCCGCGCAGTCCTGGGAGGGCGAGATCCCCGGCCGGGACCGGGTGCGGATCATCGTG
GCGGGCGCCCCGCCCCCGACCCGTACGGTGGCCCGCGTGGAGGCCGAGCTCGGCTGGGAG
TTCCTGCAGATCTACGGGCTGACCGAGACCTCCCCGCTGCTCACCGTCAACCGCGGCCGC
GCCGAGTGGGACGCGCTGCCGCCGGAGGAGCGCGCGGGCAAGCTGGTCCGGGCGGGGGCG
CCCGCGCTCGGGGTCTCGCTGCGCACCTCGGAGCAGGGCGAGGTGCTGGCCCGCTCCAAC
GTCGTCCTGGAGGGCTACTGGCGCCAGCCCGAGGCGAGCGCCGAGGCGCTGCGGGACGGC
TGGTTCCACACCGGTGACGGCGGGACCCTCGACGAGGAGGGCTACCTCACCATCAGCGAC
CGCCAGAAGGACGTGATCATCACCGGCGGCGAGAACGTCTCCTCCGTCGAGGTGGAGGAC
GCCCTCTTCAGCCACCCCGCGGTGGAGGAGGTCGCGGTGATCGGCGTGCCCGACGAGAAG
TGGGGCGAGACCATCAAGGCCCTGGTGGTCCGCGCCCCGGACACCGAGGTGGACGAGGCC
GAGCTGATCCGGCACTGCAAGGACCGCCTCGCCGGGTACAAGGCGCCCACCTCGGTGGAG
TTCCGCGACACCCTCGCCCGCACGGCCACCGGCAAGCTCCAGAAGTTCAAGCTGCGCGAG
CCGTACTGGCAGGGGCGCGAGCGCGGAGTGAACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [39-433]  4.49999999999996e-88 PF00501
PF00501   AMP-binding
IPR025110 Domain of unknown function DUF4009 (Domain)
 [473-505]  5.5e-06 PF13193
PF13193   DUF4009
SignalP
 [1-19]  0.159 Signal
Eukaryota   
TMHMM No significant hit