close all open/close all

CDS information : Salino_00470


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction48,851 / 50,872 / + [in whole cluster]
48,851 / 50,872 / + [in contig]
Location48851..50872 [in whole cluster]
48851..50872 [in contig]
TypeCDS
Length2,022 bp (673 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)2,4-dienoyl-CoA reductase (NADPH)
Gene
Gene (GenBank)fadH
EC number1.3.1.34
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[2,4-dienoyl-CoA reductase (NADPH)]
MSRYPHLLEPLDLGFTTLPNRVLMGSMHVGLEEAEDGFARMAAFYAARARGGVGLIVTGG
IAPNEVGRPWAGGAKLTTAEEAAEHRVITEAVHREGGRIAMQILHFGRYAYHEDLVAPSA
LQAPISPFPPHALSEEEIEQTIEDFARAAELAKEAGYDGVEIMGSEGYLINEFIAAATNH
REDRWGGSYENRMRFPVEIVRRVRERVGPDFILIYRLSMLDLVPGGSTLEEVLTLARAVE
AAGASIINTGIGWHEARIPTIATSVPRGAYAWVTKKVMGEVGVPLVAVNRINTPEIAEDL
LADGVCDMVSLARPLLADPDFVAKARAEKSEAINTCIGCNQACLDHTFSLKITSCLVNPR
ACHETELVLAPTRRRKRVGVIGAGPAGLACAVSAAERGHEVTLYDAAQEIGGQLNVARKV
PGKQEFDETLRYFRHQLAEHGVDVRLGTAVSAEKLAGEEYDEIVVATGVSPRIPEIAGID
HPSVVGYLDVLREEVPVGERVAILGAGGIGFDVAEFLTDEGDHASADPEVFFRHWGVDTG
YATGGGLTAPARPAQQRTVHLLQRKTSKVGAGLGKTTGWIHRLELRHRGVNMVAGVTYER
IDDEGLHLTVDGQPEVLAVDTVVLCTGQEPRRDLYEELLATGRSVHLIGGADVAAELDAK
RAIKQGTELAAAL
selected fasta
>[2,4-dienoyl-CoA reductase (NADPH)]
ATGAGCCGATACCCGCACCTGCTCGAACCCCTCGATCTGGGCTTCACCACCCTGCCCAAC
CGCGTGCTCATGGGCTCGATGCACGTCGGACTCGAAGAGGCCGAGGACGGCTTCGCGCGG
ATGGCCGCCTTCTACGCGGCCCGCGCCCGCGGCGGTGTCGGCCTCATCGTCACCGGCGGC
ATCGCCCCGAACGAGGTCGGCCGGCCCTGGGCGGGCGGCGCCAAGCTGACCACCGCCGAG
GAGGCCGCCGAGCACCGGGTGATCACCGAGGCGGTGCACCGCGAGGGCGGCCGGATCGCC
ATGCAGATCCTGCACTTCGGCCGGTACGCCTACCACGAGGACCTCGTCGCCCCGAGCGCC
CTCCAGGCGCCCATCAGCCCCTTTCCGCCGCACGCCCTGAGCGAGGAGGAGATCGAGCAG
ACCATCGAGGACTTCGCGCGCGCGGCCGAGCTGGCCAAGGAGGCGGGCTACGACGGCGTC
GAGATCATGGGCTCCGAGGGCTACCTCATCAACGAGTTCATCGCCGCCGCCACCAACCAC
CGCGAGGACCGCTGGGGCGGCTCCTACGAGAACCGGATGCGCTTCCCGGTGGAGATCGTC
CGGCGGGTCCGCGAGCGGGTGGGCCCCGACTTCATCCTGATCTACCGGCTCTCCATGCTG
GACCTGGTCCCCGGCGGCTCCACCCTGGAGGAGGTGCTCACCCTGGCCCGCGCCGTCGAG
GCGGCCGGGGCCAGCATCATCAACACCGGCATCGGCTGGCACGAGGCGCGCATCCCCACC
ATCGCCACCTCGGTGCCGCGCGGGGCCTACGCCTGGGTGACCAAGAAGGTCATGGGCGAG
GTGGGCGTGCCGCTGGTCGCGGTGAACCGGATCAACACCCCCGAGATCGCCGAGGACCTG
CTCGCCGACGGCGTCTGCGACATGGTCTCGCTGGCCCGGCCGCTCCTCGCCGACCCCGAC
TTCGTGGCCAAGGCGCGGGCCGAGAAGTCCGAGGCGATCAACACCTGCATCGGCTGCAAC
CAGGCCTGCCTCGACCACACCTTCAGCCTCAAGATCACCTCCTGCCTGGTCAACCCGCGG
GCCTGCCACGAGACCGAACTCGTCCTCGCGCCCACCCGGCGGCGCAAACGCGTCGGTGTC
ATCGGCGCCGGTCCCGCCGGGCTCGCCTGCGCCGTCTCCGCCGCCGAACGCGGCCACGAG
GTCACCCTCTACGACGCCGCCCAGGAGATCGGCGGTCAGCTCAACGTCGCCCGCAAGGTC
CCCGGCAAGCAGGAGTTCGACGAGACGCTGCGCTACTTCCGCCACCAGCTCGCCGAGCAC
GGCGTGGACGTGCGCCTGGGCACCGCGGTCAGCGCGGAGAAGCTGGCCGGGGAGGAGTAC
GACGAGATCGTGGTCGCCACCGGGGTCAGCCCGCGGATCCCGGAGATCGCCGGGATCGAC
CACCCCAGCGTGGTCGGCTACCTCGACGTGCTGCGCGAGGAGGTGCCGGTCGGCGAGCGG
GTCGCGATCCTCGGCGCCGGAGGCATCGGCTTCGACGTGGCCGAGTTCCTCACCGACGAG
GGCGACCACGCGAGCGCCGACCCGGAGGTCTTCTTCCGCCACTGGGGCGTCGACACCGGG
TACGCCACCGGCGGCGGCCTCACCGCACCCGCGCGCCCCGCCCAGCAGCGCACCGTGCAC
CTGCTCCAGCGCAAGACCTCCAAGGTCGGCGCCGGGCTCGGCAAGACCACCGGCTGGATC
CACCGCCTCGAACTGCGCCACCGCGGCGTCAACATGGTCGCCGGTGTCACCTACGAGCGG
ATCGACGACGAGGGCCTGCACCTCACCGTGGACGGGCAGCCCGAGGTGCTCGCCGTGGAC
ACCGTCGTCCTGTGCACCGGCCAGGAGCCCCGGCGCGACCTGTACGAGGAGCTGCTCGCC
ACGGGCCGCAGCGTGCACCTCATCGGGGGCGCCGACGTCGCCGCCGAACTCGACGCCAAG
CGCGCCATCAAGCAGGGCACCGAACTCGCCGCCGCCCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001155 NADH:flavin oxidoreductase/NADH oxidase, N-terminal (Domain)
 [7-329]  3.90000000000001e-88 PF00724
PF00724   Oxidored_FMN
IPR013027 FAD-dependent pyridine nucleotide-disulphide oxidoreductase (Family)
 [378-397]  4.00000300869883e-16 PR00368 [460-478]  4.00000300869883e-16 PR00368 [500-518]  4.00000300869883e-16 PR00368 [619-635]  4.00000300869883e-16 PR00368
PR00368   FADPNR
IPR013785 Aldolase-type TIM barrel (Domain)
 [4-367]  1.60000000000002e-120 G3DSA:3.20.20.70
G3DSA:3.20.20.70   Aldolase_TIM
IPR016040 NAD(P)-binding domain (Domain)
 [372-522]  6.90000000000007e-73 G3DSA:3.40.50.720 [541-670]  6.90000000000007e-73 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR023753 Pyridine nucleotide-disulphide oxidoreductase, FAD/NAD(P)-binding domain (Domain)
 [378-481]  1.2e-10 PF07992
PF07992   Pyr_redox_2
SignalP No significant hit
TMHMM No significant hit