close all open/close all

CDS information : Salino_00480


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction50,944 / 51,609 / + [in whole cluster]
50,944 / 51,609 / + [in contig]
Location50944..51609 [in whole cluster]
50944..51609 [in contig]
TypeCDS
Length666 bp (221 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)PadR-like family transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[PadR-like family transcriptional regulator]
MSLPHAILIALLEKSSSGLELTRRFDKSIGYFWSATHQQIYRELGRLEREGQIRAIPAPQ
PARGKRKEYEVLPAGRAELIRWKAEQDEPKRPRDPLLLRLRASGVVGTEGLEPELRRHLD
LHRAQLAAYQEMEKRDFAPPEDTERGRVHHLVLRGGIMMESFWVEWLGEVLAGLPGQPPA
GDEAAPGADDADETAPGEGEALPGKDEAAPGKDEADRTDAG
selected fasta
>[PadR-like family transcriptional regulator]
ATGTCCCTGCCGCACGCGATCCTCATCGCCCTGCTGGAGAAGTCGTCCTCCGGTCTCGAA
CTCACCCGCAGATTCGACAAGTCGATCGGCTACTTCTGGTCCGCCACCCACCAGCAGATC
TACCGGGAACTGGGCCGTCTGGAGCGCGAGGGGCAGATCCGGGCCATCCCCGCCCCGCAG
CCCGCCCGCGGCAAACGCAAGGAGTACGAGGTCCTGCCCGCGGGCCGCGCCGAGCTGATC
CGCTGGAAGGCCGAGCAGGACGAGCCCAAACGCCCGCGCGACCCGCTGCTGCTGCGGCTG
CGCGCCTCCGGAGTGGTCGGCACCGAGGGCCTCGAACCCGAGCTGCGCCGCCATCTCGAC
CTGCACCGCGCCCAGTTGGCGGCGTACCAGGAGATGGAGAAGCGCGACTTCGCACCGCCC
GAGGACACCGAGCGCGGACGCGTCCACCACCTCGTCCTGCGCGGCGGCATCATGATGGAG
AGCTTCTGGGTGGAGTGGCTCGGCGAGGTCCTGGCCGGCCTCCCGGGGCAGCCGCCCGCC
GGGGACGAGGCGGCACCGGGGGCGGACGACGCGGACGAGACGGCGCCCGGGGAGGGCGAG
GCGTTGCCTGGAAAGGACGAGGCGGCGCCCGGAAAGGACGAGGCGGACCGGACGGACGCG
GGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005149 Transcription regulator PadR N-terminal (Domain)
 [7-79]  9.20000000000002e-09 PF03551
PF03551   PadR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [1-86]  2.5e-21 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR018309 Transcription regulator PadR, C-terminal (Domain)
 [92-174]  5.30000000000001e-24 PF10400
PF10400   Vir_act_alpha_C
SignalP
 [1-18]  0.778 Signal
Eukaryota   
TMHMM No significant hit