close all open/close all

CDS information : Salino_00500


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction53,008 / 52,592 / - [in whole cluster]
53,008 / 52,592 / - [in contig]
Locationcomplement(52592..53008) [in whole cluster]
complement(52592..53008) [in contig]
TypeCDS
Length417 bp (138 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative dihydroxyacetone kinase,phosphotransferase component
Gene
Gene (GenBank)dhaM
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[putative dihydroxyacetone kinase,phosphotransferase component]
MSETGTGPVGVVLVSHSAALARATAELATGLAPGGGEVLIEAAGGTEDGALGTSAALIVA
AARAVDRGAGVAVLADLGSAVLTVKTLLAEEDELPPGTRLVDAPFVEGAVAAYVSAAAGA
DLDGVAAAAADAYAYRKV
selected fasta
>[putative dihydroxyacetone kinase,phosphotransferase component]
ATGAGTGAGACGGGCACCGGACCGGTCGGCGTCGTCCTCGTCTCGCACAGCGCCGCGCTG
GCGCGGGCGACCGCCGAGCTGGCCACGGGTCTCGCGCCGGGCGGCGGCGAGGTCCTGATC
GAGGCGGCGGGCGGCACCGAGGACGGCGCCCTCGGCACCAGTGCCGCGCTCATCGTGGCC
GCCGCGCGTGCGGTGGACCGCGGTGCGGGCGTCGCGGTCCTCGCCGACCTCGGCAGCGCG
GTCCTCACGGTGAAGACCCTCCTCGCCGAGGAGGACGAACTGCCCCCGGGCACCCGCCTG
GTGGACGCCCCCTTCGTCGAGGGCGCGGTGGCGGCCTACGTCAGCGCCGCGGCCGGAGCG
GACCTCGACGGGGTGGCCGCGGCGGCGGCCGACGCCTACGCGTACCGCAAGGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004701 Phosphotransferase system, fructose subfamily IIA component (Domain)
 [10-124]  1.3e-18 PF03610
PF03610   EIIA-man
 [8-137]  2.19999900980708e-09 SSF53062
SSF53062   PTS_EIIA_fruc
 [8-138]  PS51096
PS51096   PTS_EIIA_TYPE_4
 [9-135]  1.70000000000001e-33 G3DSA:3.40.50.510
G3DSA:3.40.50.510   PTS_EIIA_fruc
SignalP
 [1-27]  0.454 Signal
Bacteria, Gram-positive   
 [1-25]  0.903 Signal
Eukaryota   
 [1-21]  0.516 Signal
Bacteria, Gram-negative   
TMHMM No significant hit