close all open/close all

CDS information : Salino_00510


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction53,591 / 53,001 / - [in whole cluster]
53,591 / 53,001 / - [in contig]
Locationcomplement(53001..53591) [in whole cluster]
complement(53001..53591) [in contig]
TypeCDS
Length591 bp (196 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)dihydroxyacetone kinase subunit 2
Gene
Gene (GenBank)dak2
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[dihydroxyacetone kinase subunit 2]
MTGAAALISREADRLTLLDSPIGDADHGTNLHRGFSAVATALEQEETPTPSAVLTLCGRQ
LISTVGGASGPLYGTLLRRAGKALGEAPEVSREELAAALGAGVQAVATLGGAAPGDKTMI
DALAPAAEALTTSFEAAREAAEQGAVDTTPLQARKGRASYVGERSIGHQDPGATSSALLF
AALAETAAGREGGSDE
selected fasta
>[dihydroxyacetone kinase subunit 2]
ATGACCGGGGCGGCCGCCCTGATCAGCCGGGAGGCGGACCGGCTGACCTTGCTCGACTCG
CCCATCGGCGACGCGGACCACGGCACCAATCTGCACCGCGGGTTCAGTGCCGTGGCGACC
GCCCTGGAGCAGGAGGAGACGCCCACCCCCTCCGCCGTACTGACCCTGTGCGGGCGGCAG
TTGATCTCCACCGTCGGGGGCGCCTCCGGTCCGCTGTACGGCACGCTGCTGCGGCGGGCG
GGCAAGGCGCTCGGCGAGGCGCCCGAGGTCTCCCGGGAGGAGCTGGCGGCGGCGCTCGGC
GCCGGAGTGCAGGCGGTGGCCACCCTGGGCGGCGCCGCCCCCGGCGACAAGACCATGATC
GACGCCCTGGCTCCGGCCGCGGAGGCGCTGACCACCTCCTTCGAGGCCGCGCGCGAGGCC
GCCGAGCAGGGCGCCGTGGACACCACCCCGCTCCAGGCCCGCAAGGGGCGGGCCAGTTAC
GTCGGTGAGCGCAGCATCGGCCACCAGGACCCCGGGGCGACCTCCTCGGCGCTGCTGTTC
GCCGCGCTGGCCGAGACCGCCGCGGGCCGGGAGGGCGGGTCCGATGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004007 Dak phosphatase (Domain)
 [1-185]  PS51480
PS51480   DHAL
 [21-185]  4.10000000000004e-54 PF02734
PF02734   Dak2
 [1-187]  1.20000117458134e-48 SSF101473
SSF101473   Dak2
IPR012737 Dihydroxyacetone kinase, subunit L (Domain)
 [3-184]  1.60000000000002e-67 TIGR02365
TIGR02365   Dha_L_ycgS
SignalP No significant hit
TMHMM No significant hit