close all open/close all

CDS information : Salino_00520


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction54,687 / 53,695 / - [in whole cluster]
54,687 / 53,695 / - [in contig]
Locationcomplement(53695..54687) [in whole cluster]
complement(53695..54687) [in contig]
TypeCDS
Length993 bp (330 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)dihydroxyacetone kinase subunit DhaK
Gene
Gene (GenBank)dak1
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[dihydroxyacetone kinase subunit DhaK]
MKMLINVAETVVADALRGMAAAHPELTVDVENRVIVRRDAPVAGKVALVSGGGSGHEPLH
GGFVGPGMLAAACPGEVFTSPVPDQMLRAAAAVDSGAGVLFVVKNYTGDVLNFDMAAELA
EDEGIQVAKVLVDDDVAVRDSTFTAGRRGTGATLFVHKIAGAAADEGRPLEQVREIGQRV
VERSRSFGVALSACSTPAKGSPTFDLPPGELELGVGIHGEPGRERRPMMTSREIADYAVD
SVLGDLRPRGPVLLLVNGMGATPLLELYGFHAEVQRVLAERGVVTARVLVGNYVTSLDMA
GVSVTLCEADEEMLRLWDAPVRTPALRWGV
selected fasta
>[dihydroxyacetone kinase subunit DhaK]
ATGAAGATGCTGATCAATGTCGCCGAGACGGTGGTCGCCGACGCGCTGCGCGGCATGGCG
GCGGCGCACCCCGAGCTGACCGTGGACGTCGAGAACCGGGTGATCGTGCGCCGGGACGCC
CCGGTGGCCGGGAAGGTCGCGCTGGTCTCGGGCGGTGGCTCGGGGCACGAACCCCTGCAC
GGCGGATTCGTCGGGCCCGGGATGCTCGCGGCGGCCTGTCCGGGCGAGGTCTTCACCTCT
CCGGTGCCGGACCAGATGCTGCGGGCCGCGGCGGCGGTGGACAGCGGGGCCGGGGTGCTC
TTCGTCGTCAAGAACTACACCGGCGACGTGCTCAACTTCGACATGGCCGCCGAACTCGCC
GAGGACGAGGGCATCCAGGTCGCCAAGGTCCTCGTCGACGACGACGTGGCGGTACGGGAC
AGCACCTTCACGGCGGGGCGGCGGGGCACGGGCGCCACCCTGTTCGTACACAAGATCGCC
GGGGCCGCCGCGGACGAGGGCCGGCCGCTGGAGCAGGTGCGGGAGATCGGGCAGCGGGTG
GTCGAGCGCTCCCGCAGCTTCGGGGTGGCGCTGAGCGCCTGCTCCACCCCCGCCAAGGGG
AGCCCGACCTTCGACCTGCCGCCCGGTGAACTCGAACTCGGCGTCGGCATCCACGGCGAA
CCGGGCCGGGAGCGGCGGCCGATGATGACCTCGCGCGAGATTGCCGACTACGCCGTGGAC
AGCGTGCTCGGCGACCTCCGCCCGCGCGGCCCCGTCCTGCTCCTGGTCAACGGCATGGGC
GCCACCCCGCTGCTCGAACTCTACGGATTCCACGCCGAGGTGCAGCGGGTGCTCGCCGAA
CGCGGGGTGGTGACGGCCCGCGTCCTGGTGGGCAACTATGTGACCTCGCTGGACATGGCG
GGCGTCTCGGTGACGCTGTGCGAGGCCGACGAGGAGATGCTGCGGCTGTGGGACGCGCCC
GTGCGGACGCCCGCGCTGCGCTGGGGGGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004006 Dak kinase (Domain)
 [16-329]  1e-104 PF02733
PF02733   Dak1
 [7-328]  PS51481
PS51481   DHAK
IPR012736 Dihydroxyacetone kinase DhaK, subunit 1 (Domain)
 [1-326]  TIGR02363
TIGR02363   DhaK1
SignalP No significant hit
TMHMM No significant hit