close all open/close all

CDS information : Salino_00530


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction55,352 / 55,149 / - [in whole cluster]
55,352 / 55,149 / - [in contig]
Locationcomplement(55149..55352) [in whole cluster]
complement(55149..55352) [in contig]
TypeCDS
Length204 bp (67 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[hypothetical protein]
MLTRYISEQRHENPEAAAQMLDGTAALCALLLRKAAGDTGRTQHEILQELAHGTNEHEQL
SDEGPEA
selected fasta
>[hypothetical protein]
ATGCTCACCCGGTACATCAGCGAGCAGCGGCACGAGAACCCCGAGGCCGCCGCGCAGATG
CTCGACGGCACCGCGGCCCTCTGCGCCCTGCTGCTGCGGAAGGCCGCCGGCGACACCGGA
CGCACCCAGCACGAGATCCTGCAAGAGCTGGCCCACGGGACCAACGAGCACGAGCAACTG
AGCGACGAGGGCCCGGAGGCGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
No significant hit
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit