close all open/close all

CDS information : Salino_00540


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction56,029 / 55,469 / - [in whole cluster]
56,029 / 55,469 / - [in contig]
Locationcomplement(55469..56029) [in whole cluster]
complement(55469..56029) [in contig]
TypeCDS
Length561 bp (186 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)intracellular protease, PfpI family
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[intracellular protease, PfpI family]
MPAPDLNGRRVLAVCTNYGVEQDELAQPVDHLRTAGASVDIAAPEADRIDTLVGDRDPGS
PLHATHRLGEVSADGYDLLLVPGGTLNADSLRLQDGAVALLRAFSASGRGVAAICHGPWL
AVEAGVLEGKTLTSYPSVATDIRNAGGTWVDQEVKVCGANGWTLITSRTPEDLKAFLGAV
DDALTA
selected fasta
>[intracellular protease, PfpI family]
ATGCCCGCCCCCGACCTGAACGGCCGCCGCGTGCTCGCCGTCTGCACCAACTACGGCGTC
GAACAGGACGAACTCGCCCAGCCCGTCGACCACTTGCGCACCGCGGGCGCCTCGGTCGAC
ATCGCCGCCCCGGAGGCGGACCGTATCGACACCCTCGTCGGCGACCGCGATCCCGGCTCT
CCCCTGCACGCCACGCACCGCCTCGGCGAGGTGTCCGCCGACGGCTACGACCTGCTGCTG
GTGCCCGGTGGCACGCTCAACGCCGACAGCCTGCGGCTGCAGGACGGCGCCGTGGCGCTG
CTGCGGGCGTTCTCCGCGTCCGGCCGCGGCGTCGCGGCGATCTGCCATGGGCCGTGGCTG
GCGGTGGAGGCCGGAGTCCTGGAGGGAAAGACCCTCACGTCCTACCCGTCGGTCGCCACC
GACATCCGCAACGCGGGCGGCACCTGGGTCGACCAGGAGGTGAAGGTCTGCGGCGCGAAC
GGCTGGACGCTGATCACCTCGCGCACACCCGAGGACCTCAAGGCCTTCCTCGGCGCCGTG
GACGACGCCCTGACCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002818 ThiJ/PfpI (Domain)
 [39-179]  6.60000000000002e-30 PF01965
PF01965   DJ-1_PfpI
IPR006286 Peptidase C56, PfpI (Family)
 [10-185]  PS51276
PS51276   PEPTIDASE_C56_PFPI
 [12-183]  7.4e-44 TIGR01382
TIGR01382   PfpI
SignalP No significant hit
TMHMM No significant hit