close all open/close all

CDS information : Salino_00550


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction57,629 / 56,109 / - [in whole cluster]
57,629 / 56,109 / - [in contig]
Locationcomplement(56109..57629) [in whole cluster]
complement(56109..57629) [in contig]
TypeCDS
Length1,521 bp (506 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)catalase
Gene
Gene (GenBank)katA
EC number1.11.1.6
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[catalase]
MTENTPATTSDSGAPVESDEHSLTVGAGGPILLQDSYLIEQMAQFNRERIPERQPHAKGS
GAFGRFQVTHDVSRYTKAALFQPGTETELVIRFSTVAGERGSPDTWRDPRGFAVKFYTSE
GNYDLVGNNTPVFFIKDPMKFQHFIRSQKRRADNNLRDHDMQWDFWTLSPESAHQVTWLM
GDRGIPRTWRHMNGYSSHTYLWSNAQGERFWVKYHFKTDQGIEFFTQDEGDQMCAADTDY
HTRDLFEHIQDGEFPSWTLYVQVMPYEDAAGYRFNPFDLTKVWPHADYPLVEVGRMTLDR
NPTDNHAEIEQAAFQPNNLVPGIGPSPDRMLLGRLFSYADAHRYRIGANYQQLPVNAPLA
PLHTYSKDGAMAYRKTTDPVYAPNSKGGPAADVERYGTPPSWYADGDLTRTAYVDHPEDD
DWGQAGTMVREVLDDAARERLVDNVVGHLLNGVSEPILQRAFTYWKNIDKGVGERIEQGV
RAKADEKDPKADEQANPARSGMQRKA
selected fasta
>[catalase]
ATGACAGAGAACACCCCCGCCACCACCAGTGACTCCGGAGCGCCGGTCGAGAGCGACGAG
CATTCGCTGACCGTCGGTGCCGGAGGGCCGATCCTGCTGCAGGACTCGTACCTGATCGAG
CAGATGGCGCAGTTCAACCGGGAGCGGATCCCCGAGCGGCAGCCGCACGCCAAGGGCAGC
GGTGCCTTCGGCCGCTTCCAGGTGACGCACGACGTCAGCCGGTACACGAAAGCGGCGCTG
TTCCAGCCGGGAACCGAGACGGAGTTGGTGATCCGGTTCTCGACGGTGGCCGGTGAGCGC
GGCAGCCCGGACACCTGGCGCGACCCGCGCGGCTTCGCGGTGAAGTTCTACACCAGCGAG
GGCAACTACGACCTGGTCGGCAACAACACACCGGTCTTCTTCATCAAGGACCCGATGAAG
TTCCAGCACTTCATCCGCTCCCAGAAGCGCCGCGCCGACAACAACCTGCGCGACCACGAC
ATGCAGTGGGACTTCTGGACCCTCTCTCCCGAGTCCGCGCACCAGGTCACCTGGCTGATG
GGCGACCGCGGCATCCCGCGCACCTGGCGCCATATGAACGGCTACAGCAGCCACACGTAC
CTGTGGAGCAACGCCCAGGGCGAGCGCTTCTGGGTGAAGTACCACTTCAAGACCGACCAG
GGCATCGAGTTCTTCACCCAGGACGAGGGTGACCAGATGTGCGCGGCGGACACGGATTAC
CACACCAGGGACCTCTTCGAGCACATCCAGGACGGGGAGTTCCCGAGTTGGACGCTGTAC
GTGCAGGTCATGCCGTACGAGGACGCGGCGGGCTACCGCTTCAACCCGTTCGACCTGACC
AAGGTGTGGCCGCACGCCGACTACCCGCTCGTCGAGGTCGGCAGGATGACCCTGGACCGC
AACCCCACGGACAACCACGCGGAGATCGAGCAGGCCGCGTTCCAGCCCAACAACCTGGTC
CCGGGCATCGGCCCCAGCCCCGACCGGATGCTCCTCGGCCGGCTGTTCTCGTACGCCGAC
GCCCACCGGTACCGGATCGGCGCCAACTACCAGCAGCTGCCGGTCAACGCTCCCCTCGCG
CCCCTGCACACGTACTCCAAGGACGGGGCGATGGCCTACCGCAAGACCACCGACCCGGTG
TACGCGCCGAACTCCAAGGGCGGCCCGGCCGCGGACGTCGAGCGCTACGGCACGCCGCCG
AGCTGGTACGCGGACGGCGACCTCACGCGGACCGCGTACGTCGACCATCCCGAGGACGAC
GACTGGGGCCAGGCGGGCACGATGGTGCGCGAGGTCCTCGACGACGCGGCGCGCGAGCGG
CTGGTGGACAACGTCGTCGGCCACCTGCTGAACGGGGTGAGCGAGCCGATCCTCCAACGG
GCCTTCACCTACTGGAAGAACATCGACAAGGGCGTGGGCGAGCGCATCGAGCAGGGGGTG
CGCGCCAAGGCCGACGAGAAGGACCCCAAGGCCGACGAGCAGGCGAACCCGGCCCGCTCC
GGCATGCAGCGCAAGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002226 Catalase haem-binding site (Binding_site)
 [334-342]  PS00437
PS00437   CATALASE_1
IPR010582 Catalase immune-responsive domain (Domain)
 [417-480]  1.3e-16 PF06628
PF06628   Catalase-rel
IPR011614 Catalase core domain (Domain)
 [9-388]  PF00199
PF00199   Catalase
 [9-390]  SM01060
SM01060   Catalase
 [8-358]  2.20000000000002e-91 G3DSA:2.40.180.10
G3DSA:2.40.180.10   Catalase_N
IPR018028 Catalase, mono-functional, haem-containing (Family)
 [22-45]  4.69998262513189e-66 PR00067 [84-102]  4.69998262513189e-66 PR00067 [105-122]  4.69998262513189e-66 PR00067 [124-142]  4.69998262513189e-66 PR00067 [289-316]  4.69998262513189e-66 PR00067 [321-347]  4.69998262513189e-66 PR00067
PR00067   CATALASE
 [5-486]  PS51402
PS51402   CATALASE_3
IPR020835 Catalase-like domain (Domain)
 [1-499]  SSF56634
SSF56634   Catalase_N
IPR024708 Catalase active site (Active_site)
 [45-61]  PS00438
PS00438   CATALASE_2
IPR024711 Catalase, mono-functional, haem-containing, clades 1 and 3 (Family)
 [1-487]  PIRSF038928
PIRSF038928   Catalase_clade1-3
SignalP No significant hit
TMHMM No significant hit