close all open/close all

CDS information : Salino_00560


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction58,344 / 57,892 / - [in whole cluster]
58,344 / 57,892 / - [in contig]
Locationcomplement(57892..58344) [in whole cluster]
complement(57892..58344) [in contig]
TypeCDS
Length453 bp (150 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)cyclase/dehydrase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[cyclase/dehydrase]
MSQVEESIEVGVPVSAAYNQWTQFEDFPKFMDGVERIEQRTPTLTHWKTRIAGVEREFDA
EVTEQIPDERVAWTSVGGEARQAGVVTFHRIDDDTTKIMLQLDHDPEGLADTVGDKLGLV
RRQAVGDLKRFKQFIEARGGAETGAWRGTV
selected fasta
>[cyclase/dehydrase]
GTGTCGCAGGTCGAGGAGTCCATCGAGGTCGGTGTCCCGGTCAGTGCCGCCTACAACCAG
TGGACCCAGTTCGAGGACTTTCCCAAGTTCATGGACGGCGTCGAACGGATCGAGCAGCGC
ACTCCGACCCTGACCCACTGGAAGACCAGGATCGCCGGTGTCGAGCGGGAGTTCGACGCG
GAGGTCACCGAGCAGATCCCCGACGAGCGGGTCGCGTGGACCAGCGTCGGCGGCGAGGCC
CGGCAGGCCGGTGTGGTGACCTTCCACCGTATCGACGACGACACCACCAAGATCATGCTT
CAGCTCGACCACGATCCTGAGGGCCTGGCCGACACCGTCGGAGACAAGCTCGGTCTGGTC
AGGCGCCAGGCGGTCGGCGATCTGAAGCGGTTCAAGCAGTTCATCGAGGCGCGCGGAGGC
GCCGAGACCGGCGCCTGGCGCGGCACCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005031 Streptomyces cyclase/dehydrase (Family)
 [10-123]  5e-13 PF03364
PF03364   Polyketide_cyc
IPR023393 START-like domain (Domain)
 [4-142]  1.1e-08 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP No significant hit
TMHMM No significant hit