close all open/close all

CDS information : Salino_00580


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction59,688 / 60,944 / + [in whole cluster]
59,688 / 60,944 / + [in contig]
Location59688..60944 [in whole cluster]
59688..60944 [in contig]
TypeCDS
Length1,257 bp (418 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)extracellular solute-binding protein family 1
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[extracellular solute-binding protein family 1]
MTISRRRMLATGTALGLLTACGSNTGREDGGSGKGPQLSHWYHQYGEAGTEEAVKRYAAD
YEKADVRVQWRPGNYDEQTAAALLTTSGPDVFEANGPTLDQIRGGQVLDLTEQLGDAKDD
FNPVVLKPKTYEGRIWAVPQVVDMQLLYYRKSLLSEAGVRPPRTLDELVDAAKELTGKKT
KGLFLGNDGGAGVLGGTPLNAAGLSLVTDDGKVGFDDPAAARALSKLRALYAAKSLLLGA
PSDWSDPSAFVQGLTAMQWSGLWALPAVQKALGDDFGVLPFPADGPGGKAAVPVGAYGAA
VSARARDKAAAKAYVKWLWVERTDHQRDFALSYGFHIPARLSLAKKADVLTKGPAADAVR
YSTDHGNAEPLLWTPASRVAYQDALSRIIKSGADPERELKKVVRKVSAELARTRKKSA
selected fasta
>[extracellular solute-binding protein family 1]
ATGACCATCAGCCGCAGAAGGATGCTCGCCACCGGTACGGCCCTCGGCCTGCTGACCGCC
TGCGGCTCCAACACCGGCCGGGAGGACGGCGGTTCGGGCAAGGGGCCGCAGCTCTCGCAC
TGGTACCACCAGTACGGCGAGGCCGGTACCGAGGAGGCCGTGAAGCGCTACGCCGCCGAC
TACGAGAAGGCCGACGTACGCGTCCAGTGGCGGCCCGGCAACTACGACGAGCAGACCGCC
GCCGCGCTGCTCACCACCTCGGGACCGGACGTCTTCGAGGCCAACGGACCCACCCTGGAC
CAGATCCGCGGCGGCCAGGTGCTCGACCTCACCGAGCAACTCGGGGACGCCAAGGACGAC
TTCAACCCGGTGGTCCTCAAGCCGAAGACCTACGAGGGCCGGATCTGGGCGGTGCCGCAG
GTCGTCGACATGCAGCTGCTCTACTACCGCAAGAGCCTGCTCTCCGAGGCGGGCGTGCGG
CCGCCCCGTACCCTCGACGAACTGGTCGACGCGGCAAAGGAGTTGACGGGCAAGAAGACC
AAGGGCCTGTTCCTCGGCAACGACGGCGGCGCCGGGGTCCTCGGCGGCACGCCCCTGAAC
GCGGCGGGCTTGAGCCTGGTCACCGACGACGGCAAGGTGGGCTTCGACGACCCGGCCGCC
GCCCGCGCCCTGAGCAAGCTGCGCGCCCTGTACGCGGCGAAGTCGCTGCTCCTCGGGGCC
CCTTCGGACTGGTCGGACCCCTCGGCCTTCGTCCAGGGGCTGACCGCCATGCAGTGGTCC
GGCCTGTGGGCGCTGCCCGCCGTGCAGAAGGCCCTCGGGGACGACTTCGGGGTGCTGCCC
TTCCCGGCCGACGGACCCGGTGGGAAGGCCGCGGTGCCGGTCGGCGCCTACGGGGCGGCG
GTCAGCGCCCGGGCACGGGACAAGGCGGCGGCCAAGGCGTACGTGAAGTGGCTGTGGGTC
GAACGCACCGACCACCAGCGGGACTTCGCGCTCTCCTACGGTTTCCACATCCCGGCCCGG
CTGTCCCTGGCGAAGAAGGCGGACGTCCTCACCAAGGGTCCCGCGGCCGACGCGGTGCGC
TACTCCACCGATCACGGCAACGCCGAGCCGCTGCTGTGGACGCCCGCGAGCCGGGTCGCC
TACCAGGACGCGCTGAGCCGGATCATCAAGTCCGGAGCCGACCCGGAGCGCGAGCTCAAG
AAGGTGGTGCGCAAGGTGTCGGCGGAGCTGGCCCGGACGCGGAAGAAGTCCGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006059 Bacterial extracellular solute-binding, family 1 (Family)
 [51-318]  1.2e-30 PF01547
PF01547   SBP_bac_1
SignalP
 [1-26]  0.991 Signal
Bacteria, Gram-negative   
 [1-30]  0.993 Signal
Bacteria, Gram-positive   
 [1-22]  0.963 Signal
Eukaryota   
TMHMM No significant hit