close all open/close all

CDS information : Salino_00590


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction60,941 / 61,924 / + [in whole cluster]
60,941 / 61,924 / + [in contig]
Location60941..61924 [in whole cluster]
60941..61924 [in contig]
TypeCDS
Length984 bp (327 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)binding-protein-dependent transport systems inner membrane component
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[binding-protein-dependent transport systems inner membrane component]
MSAVAEQKTAPRTETAAAPAGAGRWRRLAGPQNRNLWFWVFVGPFALGLLVFTYVPLGWS
VYLSFFDAHNTVSPTEFVGLDNYTALLRDEAFTDSLWTFAVFTAFIVPTTFVLSLSLALM
VNRLRRAQAFFRSVFFLPAACSYVVAALIWKMSLFNGVRFGLANTVLGWFGAEQTAWLST
TDPPWYWLVIVTVRLWLQAGFYMILFLAALQRISPALYEAAAVDGARPGWQVLRHITLPQ
LRATSVAVVLLLVINAFQAFDEFYNLLSDARGYPPYARPPLVYLYYTALGQGQNLGYGSA
GAVLLALIIAVVTVGQARWFGLGRKED
selected fasta
>[binding-protein-dependent transport systems inner membrane component]
GTGAGCGCAGTCGCCGAGCAGAAGACCGCCCCGCGCACGGAGACCGCGGCGGCACCGGCC
GGGGCGGGGCGGTGGCGGCGCCTGGCCGGGCCGCAGAACCGCAATCTGTGGTTCTGGGTC
TTCGTCGGCCCCTTCGCGCTCGGCCTGCTCGTCTTCACCTACGTCCCGCTGGGCTGGAGC
GTCTACCTCAGCTTCTTCGACGCCCACAACACGGTCTCGCCCACGGAGTTCGTCGGCCTC
GACAACTACACCGCGCTGCTGCGCGACGAGGCCTTCACCGACAGCCTGTGGACCTTCGCG
GTCTTCACCGCCTTCATCGTGCCGACCACCTTCGTGCTCTCGCTCTCCCTCGCGCTGATG
GTCAACCGGCTGCGCCGCGCCCAGGCCTTCTTCCGTTCGGTGTTCTTCCTGCCCGCCGCC
TGCAGCTATGTGGTCGCGGCCCTCATCTGGAAGATGTCCCTCTTCAACGGGGTGCGCTTC
GGCCTCGCCAACACCGTGCTCGGCTGGTTCGGCGCCGAGCAGACGGCCTGGCTCTCCACC
ACCGACCCGCCCTGGTACTGGCTGGTCATCGTCACCGTACGGCTGTGGCTCCAGGCCGGT
TTCTACATGATCCTCTTCCTGGCGGCGCTCCAGCGGATCTCCCCGGCGCTGTACGAGGCG
GCGGCCGTGGACGGGGCCCGGCCCGGCTGGCAGGTGCTGCGCCACATCACCCTGCCGCAG
CTGCGGGCCACCTCGGTGGCGGTGGTGCTGCTGCTCGTCATCAACGCCTTCCAGGCCTTC
GACGAGTTCTACAACCTGCTCTCGGACGCCCGCGGTTACCCGCCCTACGCCCGGCCACCG
CTGGTGTACCTGTACTACACGGCCCTCGGCCAGGGGCAGAACCTCGGCTACGGCAGCGCC
GGCGCGGTCCTGCTCGCGCTGATCATCGCCGTGGTGACGGTCGGCCAGGCGCGCTGGTTC
GGTCTCGGCCGGAAGGAGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000515 Binding-protein-dependent transport systems inner membrane component (Family)
 [112-312]  3.4e-09 PF00528
PF00528   BPD_transp_1
 [96-316]  PS50928
PS50928   ABC_TM1
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [36-58]  Transmembrane (i-o) [99-121]  Transmembrane (o-i) [128-150]  Transmembrane (i-o) [185-207]  Transmembrane (o-i) [241-260]  Transmembrane (i-o) [300-322]  Transmembrane (o-i)
Transmembrane 6