close all open/close all

CDS information : Salino_00600


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction61,926 / 62,762 / + [in whole cluster]
61,926 / 62,762 / + [in contig]
Location61926..62762 [in whole cluster]
61926..62762 [in contig]
TypeCDS
Length837 bp (278 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)sugar ABC transporter permeases protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[sugar ABC transporter permeases protein]
MYDAWIRVGRALRLSLLIALALLFLVPFYLLVRNGLSAEADITAPDWTFFPSTLHWSNVT
ELFEDSTVPMARALLNSALIAVLTTLGTLLLASLAGYGLARIPYRYAQHVFYAILGTLMI
PAAVTFVPTFVLVSSLGWVSTLRGLIVPTLFSAFACFVFRQYFLGFPRELEDAARVDGLG
YWRTYWRVVVPNTRPVFAAVGTIVFIGAWNSFLWPLVIGQDRQAWTVQVALASFTTSQVI
RLHELFIAAAVSILPLLVVFLFLQRWIVAGVERSGIDE
selected fasta
>[sugar ABC transporter permeases protein]
GTGTACGACGCGTGGATCCGGGTGGGCCGGGCGCTGCGGCTCTCCCTGCTGATCGCCCTG
GCGCTGCTCTTCCTGGTGCCCTTCTACCTCCTCGTCCGCAACGGCCTCTCCGCCGAGGCG
GACATCACCGCCCCCGACTGGACCTTCTTCCCCTCCACCCTGCACTGGTCGAACGTCACC
GAGCTGTTCGAGGACTCCACCGTCCCGATGGCGCGCGCCCTGCTCAACTCGGCGCTCATC
GCGGTCCTCACCACCCTCGGCACCCTCCTGCTCGCCTCCCTCGCGGGCTACGGACTCGCC
CGCATCCCCTACCGCTACGCCCAGCACGTCTTCTACGCGATCCTCGGCACCCTGATGATC
CCGGCCGCGGTCACCTTCGTACCGACCTTCGTGCTCGTCTCCTCGCTCGGCTGGGTCTCG
ACGCTGCGCGGGCTCATCGTGCCGACCCTCTTCTCGGCCTTCGCCTGCTTCGTCTTCCGG
CAGTACTTCCTCGGATTCCCACGGGAGTTGGAGGACGCGGCCCGGGTGGACGGGCTCGGC
TACTGGCGGACCTACTGGCGGGTGGTGGTGCCCAACACGCGGCCGGTGTTCGCCGCGGTG
GGCACCATCGTCTTCATCGGCGCCTGGAACTCCTTCCTGTGGCCGCTGGTCATCGGCCAG
GACCGGCAGGCGTGGACGGTCCAGGTCGCCCTCGCCTCCTTCACCACCTCCCAGGTGATC
CGCCTGCACGAGCTCTTCATCGCGGCGGCCGTGTCGATCCTGCCGCTCCTGGTGGTCTTC
CTCTTCCTCCAGCGCTGGATCGTGGCGGGGGTGGAACGCTCCGGCATCGACGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000515 Binding-protein-dependent transport systems inner membrane component (Family)
 [74-264]  PS50928
PS50928   ABC_TM1
 [92-271]  2.6e-19 PF00528
PF00528   BPD_transp_1
SignalP
 [1-38]  0.594 Signal
Eukaryota   
 [1-40]  0.973 Signal
Bacteria, Gram-positive   
 [1-32]  0.557 Signal
Bacteria, Gram-negative   
TMHMM
 [12-31]  Transmembrane (i-o) [77-99]  Transmembrane (o-i) [111-133]  Transmembrane (i-o) [137-159]  Transmembrane (o-i) [196-218]  Transmembrane (i-o) [245-263]  Transmembrane (o-i)
Transmembrane 6