close all open/close all

CDS information : Salino_00610


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction62,862 / 64,136 / + [in whole cluster]
62,862 / 64,136 / + [in contig]
Location62862..64136 [in whole cluster]
62862..64136 [in contig]
TypeCDS
Length1,275 bp (424 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[hypothetical protein]
MTHQPPIPTRLGLGAAALLLALAGPALPAAADSPADTGRGAAEPTVEEQRLDRAAPQEIL
RRSGFDALAPRFARALEEARTYAEAERAVSRHGAALWQRAVGRAQGRGPAGGDLSRGDDR
PLYWARLALSRELRAWTPEFTLDDGRRRALRAALETSSRGQDDIRHPGGHRVKRVLVTGF
DPFTLDRDTRIGNPSGASALALDGTLVRTAEGPARIETAVFPVRWTDFAEGTVERVLARH
LPHLDLFTTVSQGRAGRFDVERTNGAWRGGFPDNENLSRTETVPVADPASQPQWTSTTLP
YRQLTEADTGRFPVYDHTEVTEIPAGGTEPVVRPEGPTPGSTARAGGGGDYLSNEIAYRA
TLLRDRLGLPKLPGGHLHTPVLEFGAGNTDPATGAVTDPGFEKNRSDIVDQVRALVKTAV
GTAR
selected fasta
>[hypothetical protein]
GTGACTCACCAGCCCCCCATACCCACCCGGCTCGGACTCGGCGCGGCGGCGCTCCTGCTC
GCCCTCGCGGGCCCGGCCCTGCCCGCCGCCGCGGACTCCCCGGCCGACACCGGGCGCGGC
GCCGCGGAGCCCACCGTCGAGGAGCAGCGCCTCGACCGGGCCGCCCCGCAGGAGATCCTC
CGGCGCAGCGGATTCGACGCCCTCGCCCCGCGCTTCGCCCGCGCCCTGGAGGAGGCCCGT
ACGTACGCGGAGGCCGAGCGGGCGGTCAGCCGTCATGGCGCGGCGCTGTGGCAGCGGGCG
GTGGGCCGCGCCCAGGGCCGGGGTCCCGCCGGGGGCGACCTCAGCCGGGGCGACGACCGG
CCGCTGTACTGGGCCCGGCTCGCCCTGAGCCGCGAACTGCGCGCGTGGACACCGGAGTTC
ACCCTCGACGACGGCCGTCGGCGGGCCCTGCGCGCGGCCCTGGAGACCTCCTCGCGCGGC
CAGGACGACATCCGCCACCCCGGCGGCCACCGGGTGAAGCGGGTCCTGGTCACCGGCTTC
GACCCGTTCACGCTGGACCGGGACACCCGGATCGGCAACCCCTCGGGCGCGAGCGCGCTG
GCCCTGGACGGCACCCTCGTCCGGACCGCCGAGGGACCGGCCCGGATCGAGACCGCCGTC
TTCCCGGTGCGCTGGACGGACTTCGCCGAGGGCACCGTCGAGCGGGTCCTCGCCCGGCAC
CTGCCGCATCTGGACCTGTTCACCACGGTCAGCCAGGGCCGGGCCGGACGCTTCGACGTG
GAGCGCACCAACGGCGCCTGGCGCGGCGGCTTCCCGGACAACGAGAACCTCTCCCGCACC
GAGACCGTCCCGGTCGCCGACCCCGCCTCGCAGCCGCAGTGGACCTCCACCACGCTCCCG
TACCGGCAGCTCACCGAGGCGGACACCGGCCGCTTCCCGGTGTACGACCACACCGAGGTC
ACCGAGATCCCGGCGGGCGGCACCGAGCCGGTGGTCAGGCCCGAGGGGCCCACCCCCGGT
TCCACGGCGCGGGCCGGGGGCGGCGGCGACTACCTGTCCAACGAGATCGCCTACCGGGCC
ACGCTGCTCCGCGACCGCCTGGGCCTGCCGAAGCTGCCCGGCGGCCATCTGCACACCCCG
GTCCTGGAGTTCGGCGCGGGCAACACCGACCCGGCGACCGGCGCCGTCACCGACCCGGGC
TTCGAGAAGAACCGGTCGGACATCGTGGACCAGGTGCGGGCGCTGGTGAAGACGGCGGTC
GGCACGGCCCGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR016125 Peptidase C15, pyroglutamyl peptidase I-like (Family)
 [173-387]  7.90000000000001e-13 G3DSA:3.40.630.20
G3DSA:3.40.630.20   Peptidase_C15-like
 [173-424]  5.20000089003336e-27 SSF53182
SSF53182   Peptidase_C15-like
SignalP
 [1-31]  1 Signal
Bacteria, Gram-positive   
 [1-31]  0.999 Signal
Eukaryota   
 [1-31]  1 Signal
Bacteria, Gram-negative   
TMHMM No significant hit