close all open/close all

CDS information : Salino_00620


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction66,402 / 64,306 / - [in whole cluster]
66,402 / 64,306 / - [in contig]
Locationcomplement(64306..66402) [in whole cluster]
complement(64306..66402) [in contig]
TypeCDS
Length2,097 bp (698 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)tetracycline resistance protein
Gene
Gene (GenBank)tetM
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[tetracycline resistance protein]
MHTLNLGILAHVDAGKTSLTERLLHTVGVIDEIGRVDEGSTHTDSLPLERRRGITIKSAV
ASFTVDGVAVNLIDTPGHPDFIAEVERALRVLDGAVLVVSAVEGVQAQTRILMRTLRRLR
VPTLVFVNKVDRAGARYAPLLRALTERLAPTCLALDSVEGIGTRAARSVPLDAGDAAFTE
RLTELLAERDEALLADWLALPPGEAALPYPRLLRELAAQSRRGLVHPVLFGSAATGTGVA
ALVSRLTGLLPTAASESGGPAAGTVFKIEQGPAGDRTAWVRMFSGTVRTRQRLGYGEGRE
GKVTGIGVFAQGECRPSGTLRAGQIGTLRGLGSVRIGDRVGERGEQAAGEREFAPPSPES
APPSPESAPPSMEFAPPSLETVVVPVAGADRAALHTALLRLAEQDPLIGLRREALSGELA
VSLYGEVQKEVLQATLAEEYGVRAEFRESTTLHIERPLATGAAAEFLHAEGNPFLATVGL
RLEPAASGSGVVFRLGVELGSMPAAFFKAVEESVHGALEQGLRGWRVTDCAVTLTHCGYA
PRQSHAHAVFDKSMSSTAGDFRHLTRLVLMSALEQAGTTVLEPLHRFTLEIPAGALGSVL
PVLTRLRAVPRTSVARGEDLVLEGEVPAASVHALELRLPSLTSGEGVLSAVFGHYAPVRG
PLPARPRAEPDALRRKDYLLETVRRTTGARDQDHPVRP
selected fasta
>[tetracycline resistance protein]
TTGCACACCCTGAACCTGGGCATTCTGGCGCATGTTGACGCCGGCAAGACGAGCCTGACC
GAGCGGCTGCTGCACACCGTCGGCGTCATCGACGAGATCGGCCGCGTCGACGAGGGCAGC
ACGCACACCGACTCCCTGCCGCTGGAGCGGCGGCGCGGGATCACCATCAAGTCCGCCGTC
GCCTCCTTCACCGTGGACGGCGTCGCGGTCAACCTGATCGACACCCCCGGGCACCCGGAC
TTCATCGCCGAGGTGGAGCGCGCGCTGCGGGTACTGGACGGCGCCGTCCTGGTGGTCTCC
GCCGTGGAGGGCGTCCAGGCGCAGACCCGGATCCTGATGCGCACCCTGCGGCGGCTGCGG
GTGCCCACCCTGGTCTTCGTGAACAAGGTCGACCGGGCCGGTGCCCGGTACGCGCCCCTG
CTCCGCGCGCTCACCGAACGCCTGGCCCCCACGTGTCTCGCCCTGGACTCCGTCGAGGGC
ATCGGCACCCGGGCGGCCCGCAGCGTTCCCCTCGATGCCGGGGACGCCGCTTTCACCGAG
CGGTTGACGGAGCTGCTCGCCGAGCGGGACGAGGCGCTGCTCGCCGACTGGCTCGCGCTG
CCGCCCGGCGAGGCGGCACTCCCCTATCCCCGGCTGCTCCGGGAGCTGGCCGCGCAGTCC
CGGCGCGGCCTCGTCCACCCGGTCCTCTTCGGCTCGGCCGCCACCGGTACCGGGGTGGCC
GCCCTGGTCTCCCGGCTCACCGGCCTGCTGCCCACGGCGGCGAGCGAGTCCGGCGGACCG
GCCGCCGGTACGGTCTTCAAGATCGAGCAGGGCCCGGCGGGCGACCGGACCGCCTGGGTA
CGGATGTTCTCCGGCACTGTGCGGACCAGGCAGCGCCTCGGCTACGGCGAGGGCCGGGAG
GGCAAGGTCACCGGCATCGGCGTCTTCGCGCAGGGCGAGTGCCGCCCCTCCGGGACGCTG
CGGGCCGGGCAGATCGGCACCCTGCGCGGGCTCGGCTCGGTCCGGATCGGGGACCGCGTC
GGCGAGCGGGGCGAACAGGCCGCCGGGGAACGCGAGTTCGCCCCGCCTTCACCGGAGTCC
GCCCCGCCCTCACCGGAGTCCGCCCCACCTTCGATGGAGTTCGCCCCGCCCTCGCTGGAG
ACGGTGGTCGTCCCGGTGGCCGGAGCCGACCGCGCGGCGCTGCACACGGCGCTGCTGCGG
CTTGCCGAGCAGGACCCGCTGATCGGCCTGCGCCGCGAAGCGCTCTCGGGCGAACTGGCG
GTCTCCCTCTACGGCGAGGTCCAGAAGGAGGTCCTCCAGGCGACCCTCGCGGAGGAGTAC
GGCGTCCGGGCCGAGTTCCGCGAGAGCACCACCCTGCACATCGAACGACCCCTGGCCACC
GGCGCCGCGGCCGAGTTCCTGCACGCCGAGGGCAACCCCTTCCTCGCCACCGTGGGCCTG
CGCCTCGAACCGGCGGCGAGCGGCAGCGGGGTGGTCTTCCGGCTCGGGGTCGAACTCGGC
TCGATGCCCGCGGCCTTCTTCAAGGCCGTCGAGGAGTCCGTACACGGGGCCCTGGAGCAG
GGGCTGCGCGGCTGGCGGGTCACCGACTGCGCGGTCACCCTGACGCACTGCGGCTACGCG
CCCCGGCAGAGCCATGCCCACGCGGTCTTCGACAAGAGCATGTCGAGCACCGCGGGCGAC
TTCCGCCACCTCACCCGGCTGGTGCTGATGAGCGCCCTGGAGCAGGCCGGGACCACCGTG
CTCGAACCCCTGCACCGCTTCACCCTGGAGATCCCGGCGGGCGCCCTCGGCTCCGTACTG
CCGGTGCTCACCCGGCTGCGGGCGGTGCCGCGCACCTCGGTGGCGCGCGGCGAGGACCTC
GTCCTGGAGGGCGAGGTCCCGGCCGCCTCGGTGCACGCGCTCGAACTGCGGCTGCCCTCG
CTCACCAGCGGCGAGGGGGTGCTCTCCGCGGTCTTCGGCCACTACGCGCCGGTGCGCGGC
CCGTTGCCCGCGCGCCCGCGCGCGGAGCCCGACGCGCTCCGGCGCAAGGACTACCTCCTG
GAGACCGTCCGCCGGACCACGGGGGCGCGGGACCAGGACCATCCCGTACGTCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000640 Translation elongation factor EFG/EF2, C-terminal (Domain)
 [579-670]  0.000110000029896148 SM00838
SM00838   EFG_C
 [580-661]  1.3e-12 PF00679
PF00679   EFG_C
 [582-661]  4.20000000000001e-08 G3DSA:3.30.70.240
G3DSA:3.30.70.240   Transl_elong_EFG/EF2_C
IPR000795 Protein synthesis factor, GTP-binding (Domain)
 [5-18]  6.40000038788486e-16 PR00315 [51-59]  6.40000038788486e-16 PR00315 [71-81]  6.40000038788486e-16 PR00315 [87-98]  6.40000038788486e-16 PR00315 [123-132]  6.40000038788486e-16 PR00315
PR00315   ELONGATNFCT
 [3-251]  1.2e-53 PF00009
PF00009   GTP_EFTU
 [44-59]  PS00301
PS00301   EFACTOR_GTP
IPR002127 Tetracycline resistance protein, TetO/TetQ/TetM (Family)
 [109-132]  9.59999914716171e-19 PR01037 [225-247]  9.59999914716171e-19 PR01037 [488-502]  9.59999914716171e-19 PR01037 [503-525]  9.59999914716171e-19 PR01037
PR01037   TCRTETOQM
IPR005225 Small GTP-binding protein domain (Domain)
 [1-134]  1.1e-26 TIGR00231
TIGR00231   Small_GTP
IPR005517 Translation elongation factor EFG/EF2, domain IV (Domain)
 [450-577]  1.09999909120787e-11 SM00889
SM00889   EFG_IV
 [469-577]  7.5e-15 PF03764
PF03764   EFG_IV
IPR009000 Translation elongation/initiation factor/Ribosomal, beta-barrel (Domain)
 [235-348]  3.59999643435987e-16 SSF50447
SSF50447   Translat_factor
IPR009022 Elongation factor G/III/V (Domain)
 [374-448]  1.49999977583352e-14 SSF54980 [579-669]  1.80000149287196e-13 SSF54980
SSF54980   EFG_III_V
IPR014721 Ribosomal protein S5 domain 2-type fold, subgroup (Domain)
 [470-581]  6.40000000000001e-21 G3DSA:3.30.230.10
G3DSA:3.30.230.10   Ribosomal_S5_D2-type_fold
IPR020568 Ribosomal protein S5 domain 2-type fold (Domain)
 [470-577]  3.39999972437717e-15 SSF54211
SSF54211   Ribosomal_S5_D2-typ_fold
SignalP No significant hit
TMHMM No significant hit