close all open/close all

CDS information : Salino_00630


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction66,804 / 68,852 / + [in whole cluster]
66,804 / 68,852 / + [in contig]
Location66804..68852 [in whole cluster]
66804..68852 [in contig]
TypeCDS
Length2,049 bp (682 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[hypothetical protein]
MSGSSNDAAANRPGRASTPRRRALLGAGVLAAATLGFPGSGVSDSRTRSTMPAPASGAPA
AESARPLLLQVLAHPDDDLYFMNPDTQRALAAKVPVVCVYVTAGEADGVNRIPGQPLPAA
DREAYSAARHQGLRQAYAALLGLPVFAAWRTRITQLPGGRKAETATLEHQGRTVELVFLN
LAMHTLGGHQAVPALWRERGLRLRTALAAGSPLGSVQSYDAEGLLSVLVGLFARYRPSLV
QTLDPDPDIQHSDTRTRIRDSEQPGYSDHGDHTAVALFTWAALARWADSAVGGPPPFAVT
AFRGYYNNHWPKNLPAPVLAEKAERLVPYGAAPDWACGNPSGCGDYNVGGDRPLRNRKGW
VRATHHRHPGPRLALAPGGRRLTAYGVLGMRAVRWQEGAEGEFGAAQDLGGGPLAPAVGF
AALDDGRHLLFALRFSALDPGGGNLREIVLLEQRRPGGPFAAWTGLGNPESDPERTRRVG
VPVAVTAPDGRVHLFVRDADQGVSTRVRTPDGEWSPWRGLGGGPVQDGLTATLTPDGAIR
VYGAGRAAVLQWSPEGFLPPLAGPVPAGAIAAADGRLLYRAPASEELLASRGERLHFPGY
GPVAAEGPYVLGRDLGGALRMLRDGRPVPGGPGAAALDGAALVADGKSAAAAGLGPDARP
WLWRPGRGWDSAGISGAAGTAT
selected fasta
>[hypothetical protein]
GTGTCCGGATCATCGAACGATGCCGCGGCGAACCGGCCGGGGCGTGCCTCCACACCCCGG
CGCAGGGCGCTGCTCGGCGCGGGTGTCCTCGCGGCGGCCACCCTCGGCTTCCCCGGCTCC
GGGGTCAGCGACTCCCGGACCCGCAGCACCATGCCCGCCCCGGCCTCGGGCGCCCCCGCC
GCCGAGTCCGCGCGCCCGCTGCTCCTGCAGGTCCTCGCCCACCCCGACGACGACCTGTAC
TTCATGAACCCGGACACCCAGCGCGCCCTGGCGGCGAAGGTGCCGGTGGTCTGCGTCTAC
GTCACCGCGGGCGAGGCGGACGGCGTCAACCGGATACCCGGGCAGCCGCTGCCCGCCGCC
GACCGCGAGGCCTACTCCGCCGCCCGCCACCAGGGCCTGCGCCAGGCCTACGCCGCCCTG
CTCGGGCTGCCCGTCTTCGCCGCCTGGCGCACCCGGATCACCCAACTCCCCGGCGGGCGC
AAGGCGGAGACGGCCACCCTGGAGCACCAGGGCCGCACCGTGGAGCTCGTCTTCCTGAAC
CTGGCCATGCACACCCTCGGCGGTCACCAGGCCGTACCCGCGCTCTGGCGGGAGCGCGGC
CTGCGGCTGCGGACCGCCCTGGCCGCGGGCTCCCCGCTCGGCTCGGTGCAGAGCTACGAC
GCGGAGGGCCTGCTCAGCGTTCTCGTCGGGCTCTTCGCGCGGTACCGGCCGAGCCTGGTC
CAGACCCTCGACCCGGACCCCGACATCCAGCACAGCGACACCCGTACCCGGATCCGCGAC
AGCGAGCAGCCGGGCTACTCCGACCACGGGGACCACACCGCCGTCGCCCTGTTCACCTGG
GCCGCGCTCGCCCGCTGGGCCGACAGCGCGGTCGGCGGGCCGCCCCCCTTCGCGGTGACC
GCCTTCCGCGGCTACTACAACAACCACTGGCCGAAGAACCTCCCCGCGCCCGTCCTCGCC
GAGAAGGCGGAGCGCCTGGTGCCCTACGGCGCCGCCCCCGACTGGGCCTGCGGAAACCCC
TCGGGCTGCGGCGACTACAACGTGGGCGGCGACCGCCCGCTGCGCAACCGCAAGGGCTGG
GTCCGCGCCACCCACCACCGGCATCCGGGCCCGCGCCTCGCGCTCGCCCCCGGCGGAAGG
CGGCTCACCGCCTACGGGGTGCTCGGGATGCGCGCGGTGCGCTGGCAGGAGGGCGCCGAG
GGCGAGTTCGGCGCCGCCCAGGACCTCGGCGGCGGACCGCTCGCGCCCGCGGTCGGCTTC
GCCGCGCTCGACGACGGGCGGCATCTGCTCTTCGCGCTGCGCTTCTCGGCCCTCGACCCC
GGTGGCGGCAACCTGCGCGAGATCGTCCTGCTCGAACAGCGGCGCCCCGGCGGCCCGTTC
GCGGCCTGGACCGGGCTCGGCAACCCCGAGTCCGACCCCGAGCGCACCCGCCGCGTCGGC
GTCCCGGTGGCGGTCACCGCACCCGACGGGCGCGTCCACCTCTTCGTCCGCGACGCCGAC
CAGGGCGTCAGCACCCGGGTGCGTACCCCGGACGGCGAGTGGTCGCCCTGGCGCGGACTC
GGCGGCGGCCCGGTGCAGGACGGACTGACCGCGACGCTCACCCCCGACGGCGCGATACGG
GTCTACGGGGCGGGCCGCGCCGCGGTCCTGCAGTGGTCGCCCGAGGGGTTCCTGCCGCCG
CTGGCCGGACCGGTTCCCGCGGGCGCCATCGCCGCGGCGGACGGCCGGCTCCTCTACCGC
GCGCCCGCCTCCGAGGAACTCCTCGCCTCCCGCGGCGAGCGCCTCCACTTCCCCGGCTAC
GGACCGGTCGCGGCCGAGGGCCCGTACGTCCTCGGCCGCGACCTCGGCGGCGCGCTGCGG
ATGCTCCGCGACGGGCGGCCGGTGCCCGGCGGCCCCGGCGCCGCCGCGCTCGACGGGGCG
GCCCTGGTGGCGGACGGCAAGAGTGCCGCGGCGGCGGGCCTGGGCCCCGACGCGCGACCC
TGGCTGTGGCGCCCGGGCCGCGGCTGGGACTCCGCCGGGATCTCCGGAGCGGCGGGCACG
GCTACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003737 N-acetylglucosaminyl phosphatidylinositol deacetylase (Family)
 [69-283]  1.3e-21 PF02585
PF02585   PIG-L
IPR006311 Twin-arginine translocation pathway, signal sequence (Conserved_site)
 [1-55]  PS51318
PS51318   TAT
IPR024078 Putative deacetylase LmbE-like domain (Domain)
 [68-156]  3.5e-10 G3DSA:3.40.50.10320 [219-304]  3.5e-10 G3DSA:3.40.50.10320
G3DSA:3.40.50.10320   G3DSA:3.40.50.10320
 [64-337]  1.39999892049878e-23 SSF102588
SSF102588   SSF102588
SignalP
 [1-36]  0.904 Signal
Eukaryota   
 [1-43]  0.545 Signal
Bacteria, Gram-negative   
 [1-60]  0.996 Signal
Bacteria, Gram-positive   
TMHMM No significant hit