close all open/close all

CDS information : Salino_00640


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction69,315 / 69,992 / + [in whole cluster]
69,315 / 69,992 / + [in contig]
Location69315..69992 [in whole cluster]
69315..69992 [in contig]
TypeCDS
Length678 bp (225 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)DNA-binding protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[DNA-binding protein]
MPTSRTTADPGAAGPALGRRVARRRAELGLSTEEAADRCCAAPAFLAYVEEGRAVPGPGL
LLRLAEALRTTVAELSEEGAPALVDGPQPPLVEMDESECRELLAGHGLGQVAVFGSEGPD
IVPVNYLLAGGEVVFRTSAGSVPAAAAGADIALEADHFDEDGKGWCVLVQGPARAVVGYD
AVLRFEEQAEHLPWSGGASGLWIALSPVRMTGRKAAPAAAPPPRA
selected fasta
>[DNA-binding protein]
ATGCCGACCTCACGCACCACCGCGGACCCCGGCGCCGCGGGACCCGCCCTCGGCCGGCGC
GTGGCCCGGCGGCGCGCGGAACTCGGCCTGAGCACGGAAGAGGCGGCGGACCGCTGCTGC
GCCGCGCCCGCCTTCCTCGCCTATGTGGAGGAGGGCCGGGCGGTACCCGGACCGGGCCTG
CTGCTCCGGCTCGCCGAGGCCCTGCGGACCACGGTGGCCGAGCTGTCCGAGGAGGGCGCC
CCCGCCCTGGTGGACGGCCCGCAGCCGCCCCTGGTGGAGATGGACGAGTCCGAGTGCCGG
GAGCTGCTGGCCGGGCACGGGCTCGGCCAGGTCGCCGTCTTCGGCTCCGAGGGCCCCGAC
ATCGTCCCCGTCAACTACCTGCTCGCCGGGGGTGAAGTGGTCTTCCGTACCTCGGCGGGC
TCGGTGCCCGCGGCCGCCGCCGGTGCCGATATCGCCCTGGAGGCCGACCACTTCGACGAG
GACGGCAAGGGCTGGTGCGTCCTCGTGCAGGGCCCCGCGCGGGCGGTGGTCGGCTACGAC
GCGGTGCTGCGCTTCGAGGAGCAGGCCGAGCACCTGCCCTGGTCGGGCGGCGCGAGCGGG
CTGTGGATCGCGCTCTCCCCGGTCCGGATGACCGGCCGCAAGGCGGCCCCGGCCGCCGCG
CCCCCGCCGCGCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001387 Helix-turn-helix type 3 (Domain)
 [21-75]  PS50943
PS50943   HTH_CROC1
 [20-75]  1.29999924468179e-11 SM00530
SM00530   HTH_XRE
IPR009002 FMN-binding split barrel-related (Domain)
 [89-217]  2.10000267834031e-18 SSF50475
SSF50475   FMN_binding
IPR010982 Lambda repressor-like, DNA-binding domain (Domain)
 [17-75]  7.80000016938413e-09 SSF47413
SSF47413   Lambda_like_DNA
 [17-77]  3.60000000000001e-10 G3DSA:1.10.260.40
G3DSA:1.10.260.40   G3DSA:1.10.260.40
IPR012349 FMN-binding split barrel (Domain)
 [88-216]  3.5e-28 G3DSA:2.30.110.10
G3DSA:2.30.110.10   PNPOx_FMN_bd
IPR024747 Pyridoxamine 5'-phosphate oxidase-related (Family)
 [95-213]  9.10000000000001e-15 PF12900
PF12900   Pyridox_ox_2
SignalP No significant hit
TMHMM No significant hit