close all open/close all

CDS information : Salino_00660


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction71,230 / 73,419 / + [in whole cluster]
71,230 / 73,419 / + [in contig]
Location71230..73419 [in whole cluster]
71230..73419 [in contig]
TypeCDS
Length2,190 bp (729 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)Pc13g00220
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[Pc13g00220]
MADTRLLQGRYRLLDLIGRGGMGEVWRARDESLGRQVAVKCLKPTGPKADRELGQGLRAR
FRREAQVAAALQHHGVTVVHDFGDADGVLFLVMELLEGRNLSQLLDDNDGRPLPVGEVEE
IAAQLADALAYTHEQSVVHRDLKPANIVRCLDGTVKICDFGIARLGHDIGFTAKITGTGI
AMGTPHYMSPEQIGGGHLDERSDLYSLGCVLYEIATGAPPFDLGDTWSILVGHRDTAPEP
PAEQRGELPGYLDEVILTLLAKEPEDRPRSARELAALIGTGRAAHTSVAPPGRPSARPGL
APPGGELPLPAWARGITAGPKAAPAPAPDVPHPALTTAWTRGWPPAPSPPAPGQEHTDLE
AQSAEARRLSAAGRWTDACEAHRRVTAGRARVLGPDHPDTLTARYELGYALSRAGRDVAA
LQEYEQAAAGRERVLGALHPDTLAARQETAYVLGRLGRHAEAHGMYAAVLAGREHTLGPE
HPDTLRCRHDLAFSLGRLGRLEESHRAAEEVAAARARVLGPGHRDTLVTRYEVGYALGRL
GRWSEALEVYGAVAGARARSLGADHPDTLAARYEMGISLGRLGRSEEALHLYRALLADRV
RLGGPEDLETLRARHGLGVNLGRLGRWPEALVEAEQVLAGRERVLGPDHPDTLVARREAA
VCLGWLGRWPEALSAYRGVAETRERLLGPGHTEVLAAREDEARCLEQLGRVQEAAALHRQ
VAALRARSG
selected fasta
>[Pc13g00220]
ATGGCGGACACCAGGCTGCTCCAGGGCCGGTACCGGCTGCTCGACCTCATCGGGCGCGGC
GGCATGGGCGAGGTGTGGCGGGCCCGGGACGAGTCCCTCGGCCGCCAGGTGGCCGTCAAG
TGCCTGAAGCCCACCGGCCCGAAGGCCGACCGCGAACTCGGGCAGGGGCTGCGCGCGCGC
TTCCGCCGGGAGGCCCAGGTCGCCGCCGCCCTCCAGCACCACGGGGTCACCGTGGTCCAC
GACTTCGGCGACGCGGACGGCGTCCTCTTCCTGGTCATGGAGTTGCTCGAAGGGCGCAAC
CTCAGCCAGCTCCTCGACGACAACGACGGCAGGCCGCTGCCCGTCGGCGAGGTGGAGGAG
ATCGCCGCCCAGCTCGCCGACGCCCTCGCGTACACCCATGAACAGAGCGTGGTGCACCGG
GACCTGAAGCCCGCCAACATCGTGCGCTGTCTGGACGGCACGGTGAAGATCTGCGACTTC
GGCATCGCCAGGCTCGGCCACGACATCGGCTTCACCGCCAAGATCACCGGCACCGGCATC
GCCATGGGCACCCCGCACTACATGTCCCCCGAGCAGATCGGCGGCGGCCACCTCGACGAG
CGCAGCGACCTCTACTCGCTGGGCTGCGTCCTGTACGAAATCGCCACCGGGGCACCGCCG
TTCGACCTCGGGGACACCTGGTCCATCCTCGTCGGCCACCGCGACACCGCCCCCGAGCCG
CCCGCCGAGCAGCGCGGCGAACTGCCCGGCTACCTCGACGAGGTCATCCTGACCCTGCTC
GCCAAGGAGCCCGAGGACAGGCCCCGTTCGGCCCGCGAACTCGCCGCGCTCATCGGCACC
GGCCGCGCCGCGCACACCTCCGTGGCCCCGCCGGGCCGCCCCTCCGCGCGCCCCGGCCTC
GCCCCGCCCGGCGGTGAACTCCCGCTCCCCGCCTGGGCGCGGGGCATCACAGCCGGTCCC
AAGGCCGCGCCCGCCCCCGCCCCGGACGTGCCGCACCCGGCGCTCACCACCGCCTGGACC
CGCGGCTGGCCGCCCGCCCCGTCCCCGCCCGCCCCGGGCCAGGAGCACACCGACCTGGAG
GCCCAGTCCGCCGAGGCCCGGCGCCTCTCGGCGGCCGGACGCTGGACCGACGCCTGCGAG
GCGCACCGCCGCGTCACCGCGGGCCGCGCCCGGGTCCTCGGTCCGGACCACCCGGACACC
CTCACCGCCCGGTACGAACTGGGCTACGCCCTGAGCCGCGCGGGCCGGGACGTGGCGGCC
CTCCAGGAGTACGAACAGGCCGCCGCCGGGCGCGAACGCGTCCTCGGCGCCCTGCACCCC
GACACCCTCGCGGCCCGCCAGGAGACCGCCTACGTCCTCGGCAGGCTCGGCCGCCACGCC
GAGGCGCACGGGATGTACGCCGCGGTCCTCGCCGGACGCGAGCACACCCTCGGCCCCGAG
CACCCCGACACCCTGCGCTGCCGCCACGACCTCGCCTTCAGCCTGGGCCGCCTCGGCCGC
CTGGAGGAGTCCCACCGTGCGGCCGAGGAGGTCGCCGCCGCCCGCGCCCGGGTCCTCGGC
CCCGGGCACCGGGACACCCTGGTGACGCGGTACGAGGTGGGCTACGCGCTCGGCCGCCTC
GGCAGATGGTCCGAGGCCCTGGAGGTCTACGGGGCGGTGGCCGGGGCCCGCGCCCGGTCC
CTCGGCGCCGACCATCCCGACACCCTGGCCGCCCGCTACGAGATGGGGATCAGCCTCGGC
AGGCTCGGCCGCAGCGAGGAGGCGCTCCACCTCTACCGCGCCCTGCTCGCGGACCGGGTC
CGGCTCGGCGGCCCCGAGGACCTGGAGACCCTGCGGGCCCGGCACGGGCTCGGCGTCAAC
CTCGGCCGCCTCGGCCGCTGGCCGGAAGCCCTGGTCGAGGCGGAGCAGGTGCTCGCGGGG
CGGGAGCGCGTCCTCGGCCCCGACCACCCCGACACCCTCGTCGCCCGCCGGGAGGCCGCC
GTCTGCCTCGGCTGGCTCGGCCGCTGGCCCGAGGCGCTGAGCGCCTACCGCGGCGTGGCC
GAGACCCGGGAGCGGCTGCTCGGCCCCGGGCACACCGAGGTACTCGCCGCCCGGGAGGAC
GAGGCCCGCTGCCTGGAGCAGCTCGGCCGGGTCCAGGAGGCCGCCGCCCTGCACCGGCAG
GTGGCCGCCCTGCGCGCCCGGTCGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000719 Protein kinase, catalytic domain (Domain)
 [11-288]  PS50011
PS50011   PROTEIN_KINASE_DOM
 [11-270]  1.99999999999999e-48 PF00069
PF00069   Pkinase
IPR011009 Protein kinase-like domain (Domain)
 [1-276]  2.99998750445706e-77 SSF56112
SSF56112   Kinase_like
IPR011990 Tetratricopeptide-like helical (Domain)
 [397-540]  1.9e-51 G3DSA:1.25.40.10 [541-676]  1.9e-51 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR017441 Protein kinase, ATP binding site (Binding_site)
 [17-40]  PS00107
PS00107   PROTEIN_KINASE_ATP
SignalP
 [1-23]  0.13 Signal
Eukaryota   
TMHMM No significant hit