close all open/close all

CDS information : Salino_00680


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction75,090 / 76,589 / + [in whole cluster]
75,090 / 76,589 / + [in contig]
Location75090..76589 [in whole cluster]
75090..76589 [in contig]
TypeCDS
Length1,500 bp (499 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)acyl-CoA synthetase
Gene
Gene (GenBank)fadD5
EC number2.3.1.86
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[acyl-CoA synthetase]
MTGVHSSTVDGLLRRSARRNPERSAVRYGDRDWSYAALDEAVSRAAAVLRATGAAAGDRV
AAFGHNSDAYLIGFLACARAGLVHVPVNQNLTGEDLAYLVRQSGSSLVLTDPDLAGNLPE
GIPVLALRDSADSLLSRLAETEPYEGPGPGAEDLAQLLYTSGTTALPKGAMMTHRALVHA
YVSALHALDLAEDDRPVHSLPLYHSAQMHVFLLPYLAVGASNLILDSPEPGRILDLVERG
EADSLFAPPTVWIGLLDHPEFARRDLGGLRKAYYGASIMPVPVLERLREGLGSPDFYNCF
GQSEIGPLATVLGPAEHAERPASCGRPVLFVEARVVDEDGAEVPPGTAGEVVYRSPQLCE
GYWDKPEESAEAFRAGWFHSGDLAVRDEQGYLTVVDRVKDVINSGGVLVASRQVEDALYG
HPAVAETAVIGLPDPRWIEAVTAVVVRKGETTEAELIAHAREQLPSFKAPKSVVFVDELP
RNASGKILKRELRETLTRP
selected fasta
>[acyl-CoA synthetase]
ATGACGGGTGTACACAGCAGTACGGTCGACGGCCTCCTGAGGCGCAGCGCACGCCGGAAC
CCGGAGCGCTCCGCCGTCCGCTACGGCGACCGCGACTGGAGCTACGCCGCCCTCGACGAG
GCCGTCTCGCGCGCGGCCGCCGTGCTGCGCGCCACCGGAGCGGCGGCCGGGGACCGCGTC
GCCGCCTTCGGCCACAACTCCGACGCCTATCTCATCGGCTTCCTCGCCTGCGCCCGCGCC
GGGCTCGTCCACGTACCCGTCAACCAGAACCTCACCGGCGAGGACCTCGCGTATCTGGTG
CGCCAGTCCGGCAGTTCGCTGGTCCTCACCGACCCGGACCTCGCCGGGAACCTCCCCGAG
GGCATCCCCGTCCTGGCGCTGCGCGACAGCGCGGACTCCCTCCTCAGCCGCCTCGCGGAG
ACCGAGCCGTACGAGGGCCCCGGGCCCGGCGCCGAGGACCTGGCGCAGCTGCTCTACACC
TCGGGCACCACGGCGCTGCCCAAGGGCGCGATGATGACGCACCGGGCGCTCGTCCACGCG
TACGTGAGCGCGCTGCACGCCCTCGACCTGGCCGAGGACGACCGGCCGGTCCACTCGCTG
CCGCTCTACCACTCGGCCCAGATGCACGTCTTCCTGCTGCCCTATCTGGCCGTCGGGGCG
AGCAACCTCATCCTGGACTCCCCGGAGCCCGGCCGGATCCTCGACCTGGTCGAACGGGGC
GAGGCGGACAGCCTGTTCGCCCCGCCGACCGTATGGATCGGGCTCCTCGACCACCCCGAG
TTCGCCCGCCGCGACCTCGGCGGACTGCGCAAGGCCTACTACGGGGCCTCGATCATGCCC
GTACCGGTCCTGGAGCGGCTGCGCGAGGGGCTCGGCTCGCCGGACTTCTACAACTGCTTC
GGCCAGAGCGAGATCGGCCCGCTGGCCACCGTGCTCGGCCCCGCCGAGCACGCCGAGCGC
CCCGCCTCCTGCGGGCGGCCGGTGCTCTTCGTGGAGGCGCGGGTGGTGGACGAGGACGGC
GCGGAGGTGCCGCCGGGCACTGCCGGTGAAGTCGTCTACCGCTCACCGCAGTTGTGCGAG
GGCTACTGGGACAAGCCGGAGGAGAGCGCGGAGGCCTTCCGGGCCGGGTGGTTCCACTCC
GGCGACCTCGCGGTCCGCGACGAGCAGGGCTACCTCACGGTGGTGGACCGGGTGAAGGAC
GTCATCAACTCCGGTGGCGTCCTGGTCGCCTCGCGGCAGGTCGAGGACGCGCTCTACGGG
CACCCGGCGGTCGCCGAGACCGCGGTGATCGGACTGCCCGACCCGCGCTGGATCGAGGCG
GTCACCGCCGTGGTCGTCCGCAAGGGCGAGACCACCGAGGCGGAGCTGATCGCCCACGCC
CGCGAGCAGCTGCCCTCCTTCAAGGCGCCCAAGTCGGTCGTCTTCGTCGACGAACTCCCG
CGCAACGCCAGCGGGAAGATCCTCAAACGCGAACTGCGCGAGACGCTCACCCGGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [34-429]  5.40000000000002e-100 PF00501
PF00501   AMP-binding
IPR025110 Domain of unknown function DUF4009 (Domain)
 [467-494]  6.70000000000001e-12 PF13193
PF13193   DUF4009
SignalP No significant hit
TMHMM No significant hit