close all open/close all

CDS information : Salino_00690


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction78,004 / 76,706 / - [in whole cluster]
78,004 / 76,706 / - [in contig]
Locationcomplement(76706..78004) [in whole cluster]
complement(76706..78004) [in contig]
TypeCDS
Length1,299 bp (432 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)phenylacetate--CoA ligase
Gene
Gene (GenBank)paaF, paaK
EC number6.2.1.30
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[phenylacetate--CoA ligase]
MESDATELLDAGERLGPEALRAVQLERLRTTLRHAYTQVPFYRKAFDAAGLRPEDCRSPA
DLARFPFTTKADLRDNYPFGMFAVPQSQVRRLHASSGTTGRPTVVGYSDRDLSLWADLVA
RSIRAAGGRPGHKVHVAYGYGLFTGGLGAHYGAERLGCTVIPASGGMTSRQVQLINDFRP
EVIMVTPSYLLTLLDEFERQGIDPRGTSLKVGIFGAEPWTEQMRQEIEERFALDAVDIYG
LSEVLGPGVAQECVETKDGLHIWEDHFYPEVVDPLTGEVLPDGEEGELVFTTLTKEAMPV
VRYRTRDLTRLLPGTARVFRRMERITGRSDDMVILRGVNLFPTQVEEIVLRTPGVAPHFQ
LRLTREGRMDALTVRAEARPRATTAEREAAAVSLAQSVKDGIGVSVRVEIVDPETLERSV
GKIRRIVDLREG
selected fasta
>[phenylacetate--CoA ligase]
ATGGAGTCGGACGCGACGGAGTTGCTGGACGCCGGGGAGCGGCTCGGCCCGGAGGCGCTG
CGCGCGGTGCAGCTGGAGCGGCTGCGCACCACGCTCCGGCACGCCTATACGCAGGTGCCC
TTCTACCGGAAGGCCTTCGACGCGGCGGGACTGCGGCCCGAGGACTGCCGCTCGCCGGCC
GATCTGGCGCGGTTCCCCTTCACCACCAAGGCGGATCTGCGCGACAACTACCCCTTCGGG
ATGTTCGCCGTACCGCAGTCGCAGGTGCGGCGCCTGCACGCCTCCAGCGGGACCACGGGC
CGCCCGACCGTCGTCGGCTACTCCGACCGGGACCTGTCCCTCTGGGCCGACCTGGTCGCC
CGCTCGATCCGCGCCGCGGGCGGCAGGCCGGGGCACAAGGTCCATGTGGCCTACGGATAC
GGGCTGTTCACCGGCGGACTCGGCGCGCACTACGGGGCCGAGCGGCTCGGCTGCACGGTG
ATCCCGGCCTCCGGCGGGATGACCTCGCGCCAGGTGCAGCTGATCAACGACTTCCGCCCC
GAGGTCATCATGGTCACCCCCTCCTATCTGCTCACCCTCCTCGACGAGTTCGAGCGGCAG
GGCATCGACCCGCGCGGCACCTCGCTGAAGGTCGGCATCTTCGGGGCGGAGCCCTGGACC
GAGCAGATGCGGCAGGAGATCGAGGAGCGCTTCGCCCTCGACGCGGTGGACATATACGGG
CTCTCCGAGGTGCTCGGCCCCGGGGTGGCGCAGGAGTGCGTGGAGACCAAGGACGGGCTG
CACATCTGGGAGGACCACTTCTACCCGGAGGTCGTCGACCCGCTGACCGGTGAGGTGCTG
CCGGACGGGGAGGAGGGCGAGCTGGTGTTCACCACGCTCACCAAGGAGGCCATGCCGGTG
GTGCGGTACCGCACCCGCGATCTGACCCGTCTGCTGCCGGGCACCGCGCGGGTCTTCCGG
CGCATGGAGCGGATCACCGGGCGCAGCGACGACATGGTGATCCTGCGCGGGGTGAACCTC
TTCCCCACCCAGGTGGAGGAGATCGTGCTGCGCACACCCGGGGTGGCCCCGCACTTCCAG
CTGCGGCTGACCCGGGAGGGCCGGATGGACGCCCTCACCGTACGGGCGGAGGCCCGGCCT
CGAGCGACCACGGCGGAGCGGGAGGCCGCGGCGGTCTCGCTCGCCCAGTCCGTCAAGGAC
GGCATCGGGGTCTCGGTGCGGGTGGAGATCGTGGACCCGGAGACCCTGGAGCGCTCGGTG
GGCAAGATCCGGCGGATCGTGGATCTGCGGGAGGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [92-356]  1e-26 PF00501
PF00501   AMP-binding
IPR011880 Phenylacetate-CoA ligase (Family)
 [13-430]  TIGR02155
TIGR02155   PA_CoA_ligase
 [7-432]  PIRSF006444
PIRSF006444   PaaK
SignalP No significant hit
TMHMM No significant hit