close all open/close all

CDS information : Salino_00700


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction78,203 / 78,445 / + [in whole cluster]
78,203 / 78,445 / + [in contig]
Location78203..78445 [in whole cluster]
78203..78445 [in contig]
TypeCDS
Length243 bp (80 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[hypothetical protein]
MSESTTKHAPLGGWNKPELDLSGARWRSSSSGRGDVEIAFVEGFIAMRNSTRPESPSLIF
TPDEWGAFVLGAREGEFDLT
selected fasta
>[hypothetical protein]
GTGTCCGAGAGCACCACCAAGCACGCCCCGCTCGGCGGCTGGAACAAGCCCGAACTCGAT
CTGAGCGGTGCCCGCTGGCGGTCCAGCAGCAGCGGCCGGGGCGATGTCGAGATCGCCTTC
GTCGAGGGCTTCATCGCCATGCGCAACAGCACCCGCCCCGAGAGCCCCTCCCTGATCTTC
ACCCCCGACGAGTGGGGAGCCTTCGTACTCGGCGCCCGCGAGGGCGAGTTCGACCTGACC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007278 Domain of unknown function DUF397 (Domain)
 [24-73]  1.4e-14 PF04149
PF04149   DUF397
SignalP No significant hit
TMHMM No significant hit