close all open/close all

CDS information : Salino_00720


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction81,126 / 79,150 / - [in whole cluster]
81,126 / 79,150 / - [in contig]
Locationcomplement(79150..81126) [in whole cluster]
complement(79150..81126) [in contig]
TypeCDS
Length1,977 bp (658 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)negative regulator of beta-lactamase expression-like protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[negative regulator of beta-lactamase expression-like protein]
MRGPATDRATPRPRRLHSALGAAAAAALLLPLFGAAPSGAEETAAPDRLQRAFSSAAGAY
HVPQSVLLGVSYLQSRWDSHNGAPSVSGGYGPMHLTDARTALKHAPHHSEGGEDPRGDSS
RRALRPSAPVPETAELPARLTTLTRAAELTGLKPAALRGDPAANIRGGAALLAAEQKRLG
KPLSDRPADWYAAVGRFSGAEDSATAAAYANDVFAVIRDGQQRTNDTGQRLRLAAVPGLE
PKASEARRMGLRRAAAKGTECPATVSCEWIPAPYEEFGDEDYGNHDLADRPKDQGIDYIV
VHDTEGSWDTTLKLVQDPTYVSWHYTLRSTDGHIAQHVKTKDVGWHAGNWYINSKSVGLE
HEGFLASPDAWYTEAMYRTSARLVKYLAQKFDIPLDRQHILGHDTVPGTTTSTIPGMHTD
PGPYWNWQHYFSLLGKPLPHRGAAQGELVTVAPEYAKNKPAFTGCTKAGEACAPHGSSAV
RVYTEPSEDAPLIKDIGLRPGGEDSTIDVNDLGSRLSAGQQYALAGKKGDWTAVWYLGQK
AWFKNPAKAPTAVFGSGSVITPKAGKAEVPVYGRAYPEKAAYPEGVPVQEVSPLPYKLLA
GQRYVTGDRVPGEYFYAPTFDTAPHKVVRGKDVYYEIQFGHRIAYVRAADVDLKRSGH
selected fasta
>[negative regulator of beta-lactamase expression-like protein]
TTGCGAGGACCCGCCACAGATCGCGCCACCCCGAGACCGCGACGCCTGCACTCCGCCCTT
GGCGCCGCCGCCGCGGCCGCTCTGCTGCTCCCGCTCTTCGGCGCCGCCCCCTCAGGTGCC
GAGGAGACCGCGGCACCGGACCGCCTCCAGCGGGCCTTCAGTTCCGCCGCCGGGGCCTAC
CACGTACCGCAGAGCGTGCTGCTCGGCGTCTCCTACCTCCAGTCCCGCTGGGACAGCCAC
AACGGCGCCCCCAGCGTCTCCGGCGGCTACGGACCCATGCACCTCACCGACGCGCGCACC
GCCCTCAAGCACGCGCCGCACCACAGCGAGGGCGGCGAGGACCCGCGCGGCGACAGCTCC
CGCCGCGCCCTGCGGCCGAGCGCGCCGGTCCCGGAGACGGCCGAGCTGCCCGCCCGGCTC
ACCACCCTGACCAGGGCGGCCGAGCTGACCGGCCTGAAGCCGGCCGCGCTGCGCGGCGAC
CCGGCGGCGAACATCCGCGGCGGCGCGGCCCTCCTCGCCGCCGAGCAGAAGCGGCTCGGC
AAGCCGCTCAGCGACCGGCCCGCCGACTGGTACGCCGCCGTCGGCCGGTTCTCCGGCGCC
GAGGACAGCGCCACCGCCGCCGCCTACGCCAACGACGTCTTCGCCGTGATCCGCGACGGG
CAGCAGCGCACCAACGACACCGGCCAGCGCCTGCGCCTGGCCGCCGTGCCCGGTCTGGAG
CCGAAGGCCTCCGAGGCGCGGCGGATGGGGCTGCGGCGCGCCGCGGCCAAGGGCACCGAG
TGCCCGGCGACGGTCTCCTGCGAGTGGATCCCGGCGCCCTACGAGGAGTTCGGCGACGAG
GACTACGGCAACCACGACCTCGCGGACCGCCCGAAGGACCAGGGCATCGACTACATCGTC
GTCCACGACACCGAGGGCTCCTGGGACACCACCCTGAAGCTGGTGCAGGACCCGACGTAC
GTCTCCTGGCACTACACGCTGCGCTCCACCGACGGGCACATCGCCCAGCACGTGAAGACC
AAGGACGTCGGCTGGCACGCGGGCAACTGGTACATCAACTCCAAGTCGGTGGGCCTGGAG
CACGAGGGCTTCCTCGCCTCCCCGGACGCCTGGTACACGGAGGCGATGTACCGCACCTCG
GCGCGCCTGGTGAAGTACCTGGCGCAGAAGTTCGACATCCCGCTCGACCGGCAGCACATC
CTCGGCCACGACACCGTGCCCGGCACCACCACCTCCACGATCCCGGGCATGCACACCGAC
CCCGGCCCGTACTGGAACTGGCAGCACTACTTCTCGCTGCTCGGCAAGCCGCTGCCGCAC
CGGGGTGCCGCCCAGGGCGAACTGGTCACCGTCGCCCCCGAGTACGCGAAGAACAAGCCC
GCGTTCACCGGCTGCACCAAGGCCGGCGAGGCCTGCGCCCCGCACGGGTCCAGCGCGGTG
CGCGTCTACACCGAGCCGAGCGAGGACGCCCCGCTGATCAAGGACATCGGTCTGCGCCCC
GGCGGCGAGGACTCCACGATCGACGTCAACGACCTGGGCTCGCGCCTGTCCGCCGGGCAG
CAGTACGCCCTGGCCGGCAAGAAGGGCGACTGGACCGCGGTCTGGTACCTCGGTCAGAAG
GCCTGGTTCAAGAACCCGGCCAAGGCGCCCACCGCGGTGTTCGGCTCCGGCTCCGTGATC
ACCCCCAAGGCGGGCAAGGCCGAGGTGCCGGTCTACGGCAGGGCCTACCCCGAGAAGGCG
GCCTACCCCGAGGGCGTCCCGGTGCAGGAGGTCTCCCCGCTGCCGTACAAGCTCCTCGCG
GGCCAGCGCTATGTCACGGGTGACCGGGTCCCCGGCGAGTACTTCTACGCGCCGACCTTC
GACACCGCGCCGCACAAGGTCGTCCGCGGCAAGGACGTCTACTACGAGATCCAGTTCGGC
CACCGCATCGCCTACGTACGCGCCGCGGATGTCGACCTGAAGCGCTCCGGCCACTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002502 N-acetylmuramoyl-L-alanine amidase domain (Domain)
 [269-440]  6.00001679190159e-38 SSF55846
SSF55846   Amidase_2
 [285-422]  3.59998852907783e-44 SM00644
SM00644   Ami_2
 [291-424]  4.00000000000001e-24 PF01510
PF01510   Amidase_2
 [284-435]  4.10000000000001e-31 G3DSA:3.40.80.10
G3DSA:3.40.80.10   Amidase_2
SignalP
 [1-40]  1 Signal
Bacteria, Gram-negative   
 [1-40]  0.991 Signal
Eukaryota   
 [1-40]  1 Signal
Bacteria, Gram-positive   
TMHMM No significant hit