close all open/close all

CDS information : Salino_00740


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction82,872 / 84,383 / + [in whole cluster]
82,872 / 84,383 / + [in contig]
Location82872..84383 [in whole cluster]
82872..84383 [in contig]
TypeCDS
Length1,512 bp (503 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)regulatory protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[regulatory protein]
MSGAPNTRLSDLFGLTGWSKGELARLVNRQAAAMGHPQLATDTSRVRRWIDRGEIPRDPV
PRVLAALFTERLGRVVTIEDLGLVRHGRAGKRLVGGSEQHPDGVPWAPERTAAVLTEFTG
MDLMLNRRGLVGAGAALAAGSALSSAMHDWLRTDPALAAATPTTDNPLHAEPAGFDRYEA
APIGSQEIEELERSVEVFRAWDAARGGGLQRKAVVGQLNEVGGMLSYRHPDHLHRRLWGV
AANLAVLAGWMSHDVGLEPTAQKYFVIAAHAAREGGDRPRAGEALSRAARQMVHLGRPDD
ALDLMKLAKSGSGDQTLPRTRAMLFTIEAWAQASMGQGQAMRRTLGAAEDLFVSDKGDVP
PPSWMQMFDEADLHGMQALAYRTLAEHDPSAASTAQRHAKEAIELRAQGRQRSQIFDYLS
LASACFLADDPEQADRYARLALVSMGSNSSHRTWDRLREMYRLTGQYAGYPRIEELRSEI
QLAMPKQVGKSTGKGKGKGGRLV
selected fasta
>[regulatory protein]
GTGAGCGGCGCACCCAACACCCGCCTTTCGGACCTGTTCGGCCTGACCGGCTGGTCCAAG
GGCGAGCTCGCGAGACTCGTGAACCGGCAGGCGGCGGCCATGGGCCATCCGCAACTGGCC
ACGGACACCTCGCGGGTGCGGCGCTGGATCGACAGGGGAGAGATCCCGCGCGATCCGGTG
CCGAGGGTGCTGGCGGCGCTGTTCACCGAGCGACTCGGCCGTGTCGTGACCATCGAGGAT
CTCGGACTGGTCCGCCACGGGCGTGCGGGGAAACGGCTCGTCGGCGGGAGCGAGCAGCAT
CCCGACGGAGTGCCTTGGGCGCCTGAGCGGACTGCCGCGGTCCTCACCGAATTCACGGGA
ATGGACCTCATGCTCAACCGACGCGGCTTGGTGGGCGCGGGTGCCGCGCTCGCCGCGGGA
TCCGCACTCAGCAGCGCCATGCACGACTGGCTGCGCACCGATCCGGCCCTCGCGGCTGCC
ACCCCCACGACCGACAACCCCCTGCACGCAGAACCCGCCGGGTTCGACCGATACGAAGCC
GCCCCCATCGGCTCCCAGGAGATCGAGGAACTGGAACGCTCGGTGGAGGTGTTCCGCGCC
TGGGACGCCGCCCGCGGCGGCGGACTTCAGCGCAAGGCGGTGGTCGGCCAGCTCAACGAG
GTGGGCGGCATGCTCAGTTACCGCCACCCCGACCATCTCCACCGGCGCCTGTGGGGCGTC
GCCGCCAACCTCGCCGTACTGGCCGGGTGGATGTCGCACGACGTGGGCCTCGAACCCACC
GCCCAGAAGTACTTCGTGATCGCCGCGCACGCGGCCCGGGAGGGCGGCGACCGGCCCCGC
GCCGGTGAGGCCCTCTCGCGGGCCGCACGGCAGATGGTGCACCTGGGCCGGCCCGACGAC
GCCCTGGACCTGATGAAGCTCGCCAAGTCGGGCTCCGGGGACCAGACCCTGCCGCGCACC
CGGGCGATGCTCTTCACCATCGAGGCCTGGGCGCAGGCCTCGATGGGCCAGGGGCAGGCC
ATGCGGCGCACCCTCGGCGCGGCGGAGGACCTCTTCGTCTCGGACAAGGGCGATGTGCCG
CCGCCCAGTTGGATGCAGATGTTCGACGAGGCGGACCTGCACGGCATGCAGGCGCTCGCG
TACCGCACCCTCGCCGAGCACGATCCCTCGGCGGCGAGCACGGCCCAGCGCCACGCCAAG
GAGGCGATCGAACTGCGCGCCCAGGGGCGGCAGCGCTCGCAGATCTTCGACTACCTCTCG
CTGGCCTCGGCGTGCTTCCTCGCCGACGACCCGGAGCAGGCGGACCGCTACGCGCGGCTC
GCGCTGGTCTCCATGGGCTCCAACTCCTCGCACCGGACCTGGGACCGGCTGCGCGAGATG
TACCGGCTCACCGGCCAGTACGCCGGGTACCCCCGGATCGAGGAGCTGCGCAGCGAGATC
CAGCTGGCGATGCCGAAGCAGGTCGGCAAGAGCACCGGAAAGGGGAAGGGCAAGGGCGGC
CGCCTGGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011990 Tetratricopeptide-like helical (Domain)
 [242-306]  6.50000000000001e-07 G3DSA:1.25.40.10 [347-442]  6.50000000000001e-07 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
SignalP No significant hit
TMHMM No significant hit