close all open/close all

CDS information : Salino_00750


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction85,919 / 84,492 / - [in whole cluster]
85,919 / 84,492 / - [in contig]
Locationcomplement(84492..85919) [in whole cluster]
complement(84492..85919) [in contig]
TypeCDS
Length1,428 bp (475 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)magnesium or manganese-dependent protein phosphatase
Gene
Gene (GenBank)prpC5
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[magnesium or manganese-dependent protein phosphatase]
MCMPSPLSPDRPGGPPPGREAVDALISRTRGLRGEVVAVRRGTPEGGDPRGRWQRALFDL
AVRHLDALDEHLAQLRDGPAPPTGPEQVPAQRRRADAPAPAPLFSRVGSAEWNLLTGEVN
WSGELYEILGRSPAAAPLTLDELPALAHEDDRAMLTALLTDCLVEAKPIDGEFRVLHRGG
AVRTVHMMAEPVLDQDGGTGSMWAVLRDVSELRRSERALDDSRGFLERRLHLAQTEHRLA
VELQESVLPPWRGSLGGAHGSGSLDLAARYLPSATASLIGGDWYDALPLPDGRSLLSVGD
LTGHGVTVTSGMAMLLGALRGMAVAGTEPGSLLGWLNQLMDSSVQPALGSAVCCRFDPAA
GSIDWAQAGHPAPLLFRDGAGRALPPPEGVLLGATSGAVYEQRTERLLPGDVLLLHTDGL
VPRRAGAAAQERLLALAPRLAGARSAQACVRTIVEEFGEIEREDDACVLVARLPR
selected fasta
>[magnesium or manganese-dependent protein phosphatase]
GTGTGCATGCCCTCCCCCCTCTCGCCGGACCGCCCCGGCGGACCGCCGCCCGGCCGCGAG
GCGGTCGATGCCCTCATCAGCCGGACCCGCGGTCTGCGCGGCGAGGTGGTGGCGGTGCGG
CGCGGGACGCCCGAGGGCGGGGATCCGCGGGGGCGTTGGCAGCGGGCCCTGTTCGACCTG
GCGGTGCGCCACCTCGACGCACTGGACGAACACCTGGCGCAACTGCGTGACGGACCGGCC
CCGCCGACCGGGCCCGAGCAGGTGCCCGCACAGCGCCGCCGGGCCGATGCCCCCGCCCCC
GCACCGCTGTTCAGCCGGGTCGGCAGCGCGGAGTGGAATCTGCTCACCGGCGAGGTGAAC
TGGTCGGGCGAGCTGTACGAGATCCTCGGCCGCTCCCCCGCCGCCGCCCCGCTGACCCTG
GACGAACTGCCCGCGCTGGCGCACGAGGACGACCGGGCGATGCTCACGGCCCTGCTCACG
GACTGCCTGGTCGAGGCGAAGCCGATCGACGGCGAGTTCCGCGTGCTGCACCGAGGCGGC
GCCGTGCGCACGGTGCACATGATGGCCGAGCCGGTGCTCGACCAGGACGGCGGCACCGGA
TCGATGTGGGCGGTGCTGCGCGATGTGAGCGAACTGCGGCGCAGCGAGCGCGCCTTGGAC
GACAGCCGCGGCTTCCTGGAGCGGCGGCTGCACCTCGCCCAGACCGAGCACCGGCTCGCG
GTGGAACTCCAGGAGTCGGTGCTGCCGCCCTGGCGGGGCTCGCTCGGCGGCGCACACGGC
AGCGGCTCCCTCGACCTGGCGGCCCGCTACCTCCCCTCCGCGACCGCCTCGCTCATCGGC
GGCGACTGGTACGACGCGCTGCCGCTGCCGGACGGCCGCAGCCTGCTGAGCGTCGGCGAC
CTGACCGGGCACGGCGTCACCGTGACCTCGGGCATGGCGATGCTCCTCGGCGCCCTGCGC
GGCATGGCGGTGGCCGGCACCGAACCGGGCAGCCTGCTCGGCTGGCTCAACCAGCTCATG
GACTCCTCCGTGCAGCCCGCGCTCGGCAGCGCCGTGTGCTGCCGCTTCGACCCCGCCGCC
GGGAGCATCGACTGGGCGCAGGCCGGACACCCCGCCCCGCTGCTGTTCCGCGACGGGGCG
GGGCGCGCCCTCCCCCCTCCGGAGGGTGTGCTGCTCGGCGCCACCTCGGGCGCCGTGTAC
GAGCAGCGCACCGAGCGGCTGCTGCCCGGGGACGTACTCCTGCTGCACACCGACGGGCTG
GTCCCGCGGCGTGCCGGGGCCGCCGCCCAGGAGCGGCTGCTCGCGCTGGCCCCGCGGCTG
GCCGGGGCCCGCTCCGCGCAGGCCTGCGTGCGCACGATCGTCGAGGAGTTCGGCGAGATC
GAGCGCGAGGACGACGCCTGCGTGCTCGTCGCGCGGCTTCCCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000014 PAS domain (Domain)
 [143-219]  2.4e-06 TIGR00229
TIGR00229   Sensory_box
IPR000700 PAS-associated, C-terminal (Domain)
 [169-221]  PS50113
PS50113   PAC
IPR001610 PAC motif (Repeat)
 [170-212]  5.59999989417023e-05 SM00086
SM00086   PAC
IPR001932 Protein phosphatase 2C-like (Domain)
 [264-475]  1.60000065022528e-06 SSF81606
SSF81606   PP2C-related
 [290-473]  3.5e-43 PF07228
PF07228   SpoIIE
 [261-473]  2.70000183580794e-22 SM00331
SM00331   PP2C_SIG
IPR013655 PAS fold-3 (Domain)
 [119-202]  3.3e-09 PF08447
PF08447   PAS_3
SignalP No significant hit
TMHMM No significant hit