close all open/close all

CDS information : Salino_00760


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction87,159 / 86,068 / - [in whole cluster]
87,159 / 86,068 / - [in contig]
Locationcomplement(86068..87159) [in whole cluster]
complement(86068..87159) [in contig]
TypeCDS
Length1,092 bp (363 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)membrane protease subunit stomatin/prohibitin-like protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[membrane protease subunit stomatin/prohibitin-like protein]
MMLEELLAAGAGLVTAGALYTAAAARVVKQYERGIVFRLGRLSGGARGPGFTMVVPGFDR
LRKVNMQIVTMPVPAQEGITRDNVTVRVDAVVYFRVVDAANAIVQVEDYRFAVSQMAQTS
LRSIIGKSDLDDLLSDREKLNQGLELMIDSPAVGWGVQIDRVEIKDVSLPDTMKRSMARQ
AEADRERRARVINADAELQASKKLAEAASVMSQQPAALQLRLLQTVVAVAAEKNSTLVLP
FPVELLRFLERAQQNTAPGPEAPAGATASPGPAPDGAPPAAPDTVPPTASEGPPPPFPEV
ALPDVPLPDMPLPEAPGAIPAPPERPDTTAAPDAGTGGGTNPAGSGPVPPGTAPRHPDGG
PAS
selected fasta
>[membrane protease subunit stomatin/prohibitin-like protein]
ATGATGCTCGAAGAACTTCTGGCAGCAGGGGCAGGCCTGGTCACCGCGGGCGCCCTGTAC
ACGGCGGCTGCCGCACGCGTGGTGAAGCAGTACGAGCGCGGCATCGTCTTCCGGCTCGGG
CGGCTCAGCGGCGGGGCCCGCGGCCCCGGCTTCACGATGGTCGTCCCCGGCTTCGACCGG
CTGCGCAAGGTGAACATGCAGATCGTGACGATGCCGGTGCCCGCGCAGGAGGGCATCACC
CGGGACAACGTCACGGTCCGGGTCGACGCGGTCGTCTACTTCCGGGTGGTCGACGCGGCG
AACGCCATCGTCCAGGTCGAGGACTACCGGTTCGCGGTCTCGCAGATGGCGCAGACCTCC
CTGCGGTCCATCATCGGCAAGAGCGATCTCGACGACCTCCTCTCCGACCGCGAGAAGCTG
AACCAGGGCCTGGAGCTGATGATCGACAGCCCGGCCGTCGGCTGGGGGGTGCAGATCGAC
CGGGTGGAGATCAAGGACGTCTCGCTGCCCGACACCATGAAGCGCTCGATGGCCCGCCAG
GCGGAGGCCGACCGGGAGCGCAGGGCCCGCGTCATCAACGCCGACGCCGAGCTGCAGGCC
TCCAAGAAGCTTGCCGAGGCGGCCTCCGTGATGTCCCAGCAGCCGGCCGCCCTCCAACTG
CGGCTGCTCCAGACCGTCGTGGCGGTCGCGGCGGAGAAGAACTCCACCCTGGTCCTCCCC
TTCCCGGTGGAGCTGCTGCGCTTCCTGGAGCGCGCCCAGCAGAACACCGCCCCGGGGCCC
GAAGCACCCGCCGGTGCCACCGCGAGCCCCGGCCCGGCACCGGACGGGGCCCCACCGGCC
GCCCCGGACACCGTCCCGCCCACCGCGTCCGAGGGCCCGCCGCCGCCCTTCCCGGAGGTC
GCGCTCCCGGATGTGCCGCTCCCGGACATGCCCCTGCCCGAGGCGCCCGGCGCCATCCCG
GCCCCGCCCGAGCGCCCGGACACAACCGCGGCACCGGACGCGGGCACCGGCGGCGGGACG
AATCCGGCGGGCTCCGGGCCGGTCCCACCCGGCACCGCGCCCCGGCATCCCGACGGCGGC
CCGGCCTCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001107 Band 7 protein (Family)
 [23-181]  8.10000734323267e-67 SM00244
SM00244   PHB
 [27-197]  4.6e-32 PF01145
PF01145   Band_7
IPR001972 Stomatin (Family)
 [30-52]  5.50001754266469e-64 PR00721 [78-99]  5.50001754266469e-64 PR00721 [113-130]  5.50001754266469e-64 PR00721 [133-156]  5.50001754266469e-64 PR00721 [157-175]  5.50001754266469e-64 PR00721 [176-197]  5.50001754266469e-64 PR00721 [201-224]  5.50001754266469e-64 PR00721
PR00721   STOMATIN
SignalP
 [1-25]  0.782 Signal
Bacteria, Gram-positive   
 [1-25]  0.975 Signal
Eukaryota   
 [1-23]  0.974 Signal
Bacteria, Gram-negative   
TMHMM No significant hit