close all open/close all

CDS information : Salino_00780


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction88,266 / 89,501 / + [in whole cluster]
88,266 / 89,501 / + [in contig]
Location88266..89501 [in whole cluster]
88266..89501 [in contig]
TypeCDS
Length1,236 bp (411 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)secreted protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[secreted protein]
MGLGLGAAAAGLAGCGTVSRPGEHGPAGPERKAAPGADSARRSAPRLIGDGSTAYTGRQP
NQPDEPVRLEPGETPPQFVVFSWDGAGEVGNGLFPRFLELAEEHGAHMTFFLSGVYLLPE
SKRRLYRPPNNTVGASDIGYLSDPHLKETLRYVRQAWLNGHEIGTHFNGHFCGGSGSVEH
WTPAQWRSEIEQAREFIKTWRTNTGWADDDPLPFDYDKELVGGRTPCLLGQGNLLPTARE
MGWRYDASSPGGVQRWPRKKQGLWDLPLQGIPFPGHSFEVLSMDYNILANQSLNSTRAPS
YNYPAWRTQATGAYLAGFRRAYETNRAPLFIGNHFEEWNGGIYMDAVEETLKRVADEKEV
RLVSFRQFVDWLDAQDPAVLDRLQSLEIGERPAGGWRKYLAAAGKGAAAVS
selected fasta
>[secreted protein]
ATGGGGCTGGGGCTGGGAGCCGCCGCCGCGGGTCTTGCCGGGTGCGGCACCGTGAGCCGC
CCGGGCGAGCACGGGCCCGCCGGGCCGGAACGCAAGGCCGCGCCGGGCGCCGACTCCGCG
CGCCGGAGCGCGCCGCGGCTCATCGGGGACGGCTCGACCGCGTACACCGGCAGGCAGCCG
AACCAGCCCGACGAGCCCGTGCGGCTCGAACCGGGCGAGACGCCACCGCAGTTCGTGGTC
TTCTCCTGGGACGGCGCGGGCGAGGTCGGCAACGGGCTCTTCCCCCGCTTCCTGGAGCTC
GCCGAGGAGCACGGCGCGCACATGACCTTCTTCCTCTCCGGGGTGTACCTGCTCCCGGAG
TCCAAGCGCCGCCTGTACCGGCCGCCGAACAACACGGTCGGCGCCTCGGACATCGGCTAC
CTCTCCGACCCGCACCTCAAGGAGACGCTGCGGTACGTGCGCCAGGCCTGGCTCAACGGC
CATGAGATCGGCACCCACTTCAACGGCCACTTCTGCGGCGGCAGCGGCAGCGTGGAGCAC
TGGACGCCCGCCCAGTGGCGCAGCGAGATCGAGCAGGCCAGGGAGTTCATCAAGACCTGG
CGGACGAACACCGGCTGGGCCGACGACGACCCGCTGCCCTTCGACTACGACAAGGAACTG
GTCGGCGGCCGCACCCCCTGCCTGCTCGGCCAGGGCAATCTGCTGCCCACCGCCCGCGAG
ATGGGCTGGCGCTACGACGCCTCCTCGCCCGGCGGCGTACAGCGCTGGCCGCGCAAGAAG
CAGGGGCTGTGGGACCTGCCGCTCCAGGGGATCCCCTTCCCCGGGCACAGCTTCGAGGTC
CTGTCGATGGACTACAACATCCTCGCCAACCAGTCGCTCAACAGCACCCGGGCCCCCTCG
TACAACTACCCGGCCTGGCGCACCCAGGCGACCGGGGCCTATCTCGCGGGCTTCCGCCGG
GCCTACGAGACCAACCGGGCGCCGCTGTTCATCGGCAACCACTTCGAGGAGTGGAACGGC
GGGATCTACATGGACGCCGTCGAGGAGACGCTGAAGCGGGTCGCGGACGAGAAGGAGGTG
CGGCTGGTGTCGTTCCGTCAGTTCGTGGACTGGCTGGACGCGCAGGACCCGGCCGTCCTC
GACCGGCTGCAGAGCCTGGAGATCGGCGAGCGGCCCGCGGGCGGCTGGAGGAAGTACCTC
GCCGCGGCGGGCAAGGGCGCGGCCGCCGTCTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002509 Polysaccharide deacetylase (Domain)
 [69-375]  7.5e-12 G3DSA:3.20.20.370
G3DSA:3.20.20.370   Polysac_deacetylase
IPR011330 Glycoside hydrolase/deacetylase, beta/alpha-barrel (Domain)
 [65-379]  8.70001261213513e-26 SSF88713
SSF88713   Glyco_hydro/deAcase_b/a-brl
SignalP
 [1-33]  0.619 Signal
Bacteria, Gram-positive   
 [1-19]  0.973 Signal
Eukaryota   
TMHMM No significant hit