close all open/close all

CDS information : Salino_00790


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction90,030 / 89,575 / - [in whole cluster]
90,030 / 89,575 / - [in contig]
Locationcomplement(89575..90030) [in whole cluster]
complement(89575..90030) [in contig]
TypeCDS
Length456 bp (151 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)bacterioferritin comigratory protein
Gene
Gene (GenBank)bcp1
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[bacterioferritin comigratory protein]
MKIGDLVEDFELPDENGEMRSLTGLLAEGPVVLFFYPAALTPGCTAEACHFRDLAAEFRA
AGGRPVGVSGDSVARQQEFSGRHTLGYPLLSDPEGGVRERFGVKRGLTVLPTKRATFVIG
TDRRVVEIVRSELRMSAHADRALAALRGLSA
selected fasta
>[bacterioferritin comigratory protein]
ATGAAGATCGGTGACCTGGTCGAGGACTTCGAACTGCCCGACGAGAACGGCGAGATGCGG
AGCCTGACCGGCCTGCTCGCCGAGGGCCCGGTGGTGCTCTTCTTCTACCCGGCCGCGCTC
ACCCCGGGCTGCACCGCCGAGGCCTGCCACTTCCGCGACCTGGCCGCGGAGTTCCGCGCC
GCGGGCGGCCGCCCGGTCGGCGTCAGCGGCGACAGCGTGGCCCGCCAGCAGGAGTTCTCC
GGCAGGCACACCCTCGGCTACCCGCTGCTCTCCGACCCCGAGGGCGGCGTCCGGGAGCGC
TTCGGCGTGAAGCGGGGCCTGACGGTGCTGCCGACCAAGCGGGCCACCTTCGTGATCGGC
ACCGACCGGCGGGTCGTCGAGATCGTCCGCAGCGAACTGCGCATGAGCGCCCACGCGGAC
CGCGCCCTGGCGGCCCTGCGCGGGCTGTCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000866 Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant (Domain)
 [3-127]  7.5e-29 PF00578
PF00578   AhpC-TSA
IPR012336 Thioredoxin-like fold (Domain)
 [1-151]  14.322 PS51352
PS51352   THIOREDOXIN_2
 [2-149]  6e-34 G3DSA:3.40.30.10
G3DSA:3.40.30.10   no description
 [2-149]  2.8e-44 SSF52833
SSF52833   Thioredoxin-like
SignalP
 [1-48]  0.137 Signal
Bacteria, Gram-positive   
TMHMM No significant hit