close all open/close all

CDS information : Salino_00800


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction90,537 / 90,160 / - [in whole cluster]
90,537 / 90,160 / - [in contig]
Locationcomplement(90160..90537) [in whole cluster]
complement(90160..90537) [in contig]
TypeCDS
Length378 bp (125 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)membrane protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[membrane protein]
MPQNISSPKLLAGLLAGAGLAHLAVPRVFDAMVPRVLPGPARTWTQASAAVEFALAAGVA
WPRTRRIAAKSAAAFFVGVFPGNVQMALDWRTKPAPLRNAALARLPLQAPLVLWAHQVGK
KAGRP
selected fasta
>[membrane protein]
ATGCCGCAGAACATCAGCTCCCCGAAACTCCTCGCCGGACTGCTCGCCGGAGCAGGCCTT
GCCCATCTCGCCGTCCCCCGGGTCTTCGACGCGATGGTGCCGCGCGTCCTGCCCGGCCCC
GCCCGCACCTGGACCCAGGCCAGCGCGGCGGTGGAGTTCGCGCTCGCCGCGGGGGTCGCC
TGGCCGCGGACCCGCCGGATCGCGGCGAAGTCGGCCGCCGCCTTCTTCGTCGGCGTCTTC
CCCGGCAACGTCCAGATGGCCCTCGACTGGCGCACGAAGCCCGCCCCGCTGCGCAACGCC
GCGCTGGCCCGGCTGCCGCTCCAGGCACCGCTCGTCCTGTGGGCGCACCAGGTCGGCAAG
AAGGCCGGCAGGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-23]  0.926 Signal
Bacteria, Gram-negative   
 [1-26]  0.981 Signal
Eukaryota   
TMHMM No significant hit