close all open/close all

CDS information : Salino_00810


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction90,754 / 91,254 / + [in whole cluster]
90,754 / 91,254 / + [in contig]
Location90754..91254 [in whole cluster]
90754..91254 [in contig]
TypeCDS
Length501 bp (166 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)transcription regulator AsnC
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[transcription regulator AsnC]
MAHQPVSLDPLDRKILAALVANARRSFVEIGQEIGLSPAAVKRRVDRMRESEVITGFTTV
VRPSALGWRTEAYVEVFCEGAAPPRRLAEVARTYPEVVAAMTVTGGADALLHIRAADIEH
FEEVLERIRAEDFVRRTNSVIVLTHLLPGSPDAGASAPPRGAEEGS
selected fasta
>[transcription regulator AsnC]
ATGGCACATCAGCCGGTGTCCCTCGACCCACTCGACCGCAAGATCCTCGCCGCCCTGGTG
GCGAACGCCCGCCGCAGCTTCGTGGAGATCGGCCAGGAGATCGGCCTCTCCCCGGCGGCC
GTCAAACGCCGGGTCGACCGCATGCGCGAGAGCGAGGTCATCACCGGCTTCACCACCGTG
GTCCGCCCGAGCGCCCTCGGCTGGCGCACCGAGGCCTATGTCGAGGTCTTCTGCGAGGGC
GCCGCCCCGCCCCGCAGGCTCGCCGAGGTGGCCCGCACCTACCCGGAGGTGGTCGCCGCC
ATGACGGTCACCGGGGGTGCCGACGCCCTGCTGCACATCCGCGCCGCCGACATCGAGCAC
TTCGAGGAGGTGCTCGAACGCATCCGGGCCGAGGACTTCGTCCGCCGCACCAACAGCGTC
ATCGTCCTGACCCACCTGCTGCCCGGCTCGCCCGACGCCGGTGCCTCGGCCCCGCCGCGG
GGCGCCGAGGAGGGCTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000485 HTH transcription regulator AsnC-type DNA-binding domain (Domain)
 [8-69]  36.307 PS50956
PS50956   HTH_ASNC_2
 [8-24]  6.5e-12 PR00033 [24-35]  6.5e-12 PR00033 [35-54]  6.5e-12 PR00033
PR00033   HTHASNC
IPR011008 Dimeric alpha-beta barrel (Domain)
 [68-149]  5.1e-15 SSF54909
SSF54909   Dimeric alpha+beta barrel
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [6-58]  1.6e-17 G3DSA:1.10.10.10
G3DSA:1.10.10.10   no description
IPR019887 Transcription regulator AsnC-type, C-terminal (Domain)
 [74-143]  3.7e-15 PF01037
PF01037   AsnC_trans_reg
 [62-141]  3e-16 G3DSA:3.30.70.920
G3DSA:3.30.70.920   no description
IPR019888 Transcription regulator AsnC-type (Family)
 [8-115]  1.2e-36 SM00344
SM00344   helix_turn_helix ASNC type
SignalP
 [1-23]  0.24 Signal
Bacteria, Gram-positive   
TMHMM No significant hit