close all open/close all

CDS information : Salino_00820


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction91,473 / 92,249 / + [in whole cluster]
91,473 / 92,249 / + [in contig]
Location91473..92249 [in whole cluster]
91473..92249 [in contig]
TypeCDS
Length777 bp (258 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)amidinotransferase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[amidinotransferase]
MCEPRYFDVTYAINPWMTEGAPVDPALALAQWQELVDTYRSLGHTVELLEPVPGLPDMVF
AANGAAVVGGRVLGSRFYAPERVAEAPAHQAWFKAAGFDVREPEFVCEGEGDLVTVGRHL
LAGTGFRTALAAHQEAQEYLGIPVVSLHLTDPYFYHLDTALFALDDENIAYYPEAFSPGS
REALQRLYPDAILATREDAFAFGLNAVSDGRHVIVSPGAGQLTAQLAERGYEPIPVDLSE
LHKAGGSAKCCTQEVRPA
selected fasta
>[amidinotransferase]
ATGTGCGAGCCGCGCTACTTCGACGTGACCTACGCGATCAACCCCTGGATGACCGAGGGC
GCACCGGTCGACCCGGCCCTGGCCCTCGCCCAGTGGCAGGAGCTGGTCGACACCTACCGC
TCGCTCGGTCACACCGTGGAGCTCCTCGAACCGGTGCCCGGGCTGCCCGACATGGTCTTC
GCGGCCAACGGCGCCGCCGTGGTCGGCGGCCGGGTGCTCGGCTCCCGCTTCTACGCCCCC
GAGCGGGTGGCGGAGGCCCCGGCGCACCAGGCCTGGTTCAAGGCGGCGGGCTTCGACGTA
CGGGAGCCCGAGTTCGTCTGCGAGGGCGAGGGCGACCTGGTGACGGTCGGCCGGCACCTG
CTCGCGGGAACCGGCTTCCGCACCGCGCTCGCCGCGCACCAGGAGGCGCAGGAGTACCTT
GGGATCCCGGTGGTCAGCCTGCACCTGACCGACCCGTACTTCTACCACCTCGACACGGCG
CTGTTCGCCCTCGACGACGAGAACATCGCCTACTACCCGGAGGCCTTCTCGCCGGGCAGC
CGGGAGGCGCTGCAGCGGCTGTACCCGGACGCGATCCTGGCCACCCGCGAGGACGCCTTC
GCCTTCGGCCTCAACGCCGTCTCCGACGGCCGCCATGTGATCGTCTCGCCGGGCGCCGGG
CAGCTCACCGCCCAGCTCGCCGAGCGCGGCTACGAACCGATCCCCGTCGATCTCTCCGAA
CTGCACAAGGCCGGCGGAAGCGCCAAGTGCTGCACCCAGGAGGTACGTCCCGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003198 Amidinotransferase (Family)
 [1-255]  7.6e-35 PF02274
PF02274   Amidinotransf
SignalP
 [1-28]  0.082 Signal
Eukaryota   
TMHMM No significant hit