close all open/close all

CDS information : Salino_00830


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction92,246 / 93,475 / + [in whole cluster]
92,246 / 93,475 / + [in contig]
Location92246..93475 [in whole cluster]
92246..93475 [in contig]
TypeCDS
Length1,230 bp (409 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)ornithine aminotransferase
Gene
Gene (GenBank)rocD
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[ornithine aminotransferase]
MTAQPQNTGRRSSAELIHAEESRLAHNYHPLPVVVAKAEGAWVEDVEGRRYLDMLAGYSA
LNFGHRHPALIEAAHRQLDQLTLTSRAFHNDRLAGFAEQLSDLTGLDMTLPMNTGAEAVE
SGIKLARKWAYEVKGVAPDQANIVVAAGNFHGRTTTIVSFSDDPVARTGFGPFTPGFRTV
PYDDLAALEAAVDENTAAVLIEPIQGEAGVLIPTDGYLAGVRELTRRANVLFIADEIQSG
LGRTGTTLAVAHEAVLPDLLLLGKALGGGIVPVSAVVGRREVMSVLGPGQHGSTFGGNPL
AAAVGSAVVDLLETGEFQQRAKDLGVVLADRLSALVGHGVVGYRARGLWAGVDIDPAFGT
GREISERLMAEGVLVKDTHGSTIRFAPPLSISEEDLVSGLGALETVLAG
selected fasta
>[ornithine aminotransferase]
ATGACCGCTCAGCCCCAGAACACCGGCCGCCGCTCCTCGGCCGAGCTGATCCACGCCGAG
GAGTCCCGGCTCGCGCACAACTACCACCCGCTGCCGGTGGTGGTCGCGAAGGCCGAGGGC
GCCTGGGTCGAGGACGTCGAGGGACGCCGCTACCTGGACATGCTGGCCGGGTACTCGGCG
CTGAACTTCGGCCACCGCCACCCGGCGCTCATCGAGGCCGCGCACCGCCAGCTCGACCAG
CTCACGCTGACCTCGCGGGCCTTCCACAACGACCGCCTGGCGGGCTTCGCCGAACAGCTC
TCCGACCTCACCGGCCTCGACATGACGCTGCCGATGAACACCGGCGCGGAGGCCGTGGAG
AGCGGCATCAAGCTGGCCCGCAAATGGGCGTACGAGGTCAAGGGGGTCGCCCCGGACCAG
GCGAACATCGTGGTGGCCGCGGGCAACTTCCACGGCCGGACCACCACCATCGTCAGCTTC
TCCGACGACCCGGTGGCCCGCACCGGCTTCGGCCCCTTCACCCCGGGCTTCCGCACGGTG
CCCTACGACGACCTGGCCGCCCTGGAGGCCGCCGTCGACGAGAACACGGCCGCCGTGCTG
ATCGAGCCCATCCAGGGCGAGGCGGGGGTGCTCATCCCCACCGACGGCTACCTCGCCGGG
GTCCGGGAGCTGACCCGGCGCGCCAACGTCCTGTTCATCGCCGACGAGATCCAGTCGGGC
CTCGGCCGCACCGGCACCACCCTGGCCGTGGCGCACGAGGCCGTCCTGCCCGATCTGCTG
CTGCTCGGCAAGGCGCTCGGCGGCGGCATCGTGCCGGTCTCGGCGGTGGTCGGCAGGCGC
GAGGTGATGAGTGTGCTCGGCCCCGGCCAGCACGGCTCCACCTTCGGCGGCAACCCGCTG
GCGGCGGCCGTCGGCAGCGCGGTCGTCGACCTCCTGGAGACCGGCGAGTTCCAGCAGCGC
GCCAAGGACCTCGGCGTGGTGCTCGCCGACCGGCTCTCCGCCCTGGTCGGGCACGGGGTG
GTCGGCTACCGGGCGCGCGGCCTGTGGGCGGGCGTCGACATCGACCCGGCCTTCGGCACG
GGGCGTGAGATCAGCGAGCGGCTGATGGCCGAGGGCGTCCTGGTGAAGGACACCCACGGC
TCGACGATCCGGTTCGCCCCGCCGCTGTCGATCAGCGAGGAGGACCTGGTCTCCGGGCTC
GGCGCGCTGGAGACCGTACTCGCGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005814 Aminotransferase class-III (Family)
 [35-355]  1.9e-99 PF00202
PF00202   Aminotran_3
 [232-269]  PS00600
PS00600   AA_TRANSFER_CLASS_3
IPR010164 Ornithine aminotransferase (Family)
 [14-407]  5.1e-146 TIGR01885
TIGR01885   Orn_aminotrans: ornithine--oxo-acid transaminase
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [68-313]  4.7e-85 G3DSA:3.40.640.10
G3DSA:3.40.640.10   no description
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [316-408]  1.5e-37 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   no description
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [7-408]  2.6e-122 SSF53383
SSF53383   PLP-dependent transferases
SignalP No significant hit
TMHMM No significant hit