close all open/close all

CDS information : Salino_00850


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction94,896 / 96,344 / + [in whole cluster]
94,896 / 96,344 / + [in contig]
Location94896..96344 [in whole cluster]
94896..96344 [in contig]
TypeCDS
Length1,449 bp (482 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative major facilitator superfamily transporter
Product (GenBank)putative resistance protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in salinomycin biosynthesis.
Note (GenBank)
  • orf2
Reference
ACC
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)
Related Reference
ACC
O34718
PmId
[11807058] Identification of two myo-inositol transporter genes of Bacillus subtilis. (J Bacteriol. , 2002)
ACC
P15729
PmId
[2129397] Sequence conservation among the glucose transporter from the cyanobacterium Synechocystis sp. PCC 6803 and mammalian glucose transporters. (Plant Mol Biol. , 1990)

close this sectionSequence

selected fasta
>putative major facilitator superfamily transporter [putative resistance protein]
MTSQTNTQTGEDEDPVHLSERGMARARRWAWMIALGGFLFGYDTGVVSGALLFVRREFDL
NSFEQGSVVSILLLGAMVGALGAGRVADRLGRRRTLALEGVVFALGTVIVVTATGYPVLL
AGRIVLGLAIGGASATVPLYLSEVSPPQIRGRNLTLNQLMITTGILVSYLVDLSLASSGE
WRWMFGAGLVPALALVLCCTRLPESASWLIARGREDEARRAMRQVTEDEAGAAALVERFR
RRDEREARAAESAHVHGKGWRVLLAAPFRPALVVGLTVAAVQQLGGINTIIYYAPTIIEN
TGLTASNSIFYSVFIGLINLAMTLVAVRFVDRKGRRPLMLFSLTGMLLTLILMGLAFVAD
FSSVIALVFMVLYIASFAAGLGPVFWVLVGEVFPPSVRAVGSSAATSVNWLANFTVGLVF
LPLADAIGQGETFWIFAGVCAFGLWFVARYVPETRGASAEEIQEGLAKRFHRGGGTSAGR
GA
selected fasta
>putative major facilitator superfamily transporter [putative resistance protein]
ATGACGAGCCAGACGAACACGCAGACCGGCGAGGACGAGGACCCCGTCCACCTCTCCGAG
CGGGGCATGGCCAGGGCCCGGCGCTGGGCCTGGATGATCGCGCTCGGCGGCTTCCTCTTC
GGCTACGACACCGGCGTCGTCTCCGGTGCCCTGCTCTTCGTACGCCGGGAGTTCGACCTG
AACTCCTTCGAGCAGGGCAGCGTGGTCAGCATCCTGCTGCTCGGCGCCATGGTGGGCGCG
CTCGGCGCGGGCCGGGTCGCCGACCGGCTCGGGCGGCGGCGGACCCTCGCCCTGGAAGGA
GTGGTCTTCGCCCTGGGCACCGTGATCGTGGTGACCGCCACCGGCTATCCGGTGCTGCTC
GCCGGGCGGATCGTGCTCGGCCTCGCGATCGGCGGTGCCTCGGCGACCGTGCCGCTCTAC
CTCTCCGAGGTCTCGCCGCCGCAGATCCGGGGCCGCAACCTCACCCTCAACCAGCTGATG
ATCACCACCGGCATCCTGGTCTCGTACCTCGTCGACCTCTCTCTGGCGAGCAGCGGGGAG
TGGCGCTGGATGTTCGGCGCCGGTCTCGTCCCGGCGCTCGCCCTGGTGCTCTGCTGCACC
CGGCTGCCCGAGTCGGCCTCCTGGCTGATCGCGCGGGGCCGCGAGGACGAGGCCCGCAGG
GCCATGCGGCAGGTCACCGAGGACGAGGCGGGTGCCGCCGCGCTCGTGGAGCGCTTCCGG
CGCCGGGACGAGCGGGAGGCCCGGGCCGCCGAGTCCGCGCATGTGCACGGCAAGGGCTGG
CGGGTGCTGCTCGCGGCGCCCTTCAGGCCCGCCCTGGTGGTGGGGCTCACGGTGGCGGCC
GTCCAGCAGCTCGGCGGCATCAACACGATCATCTACTACGCGCCCACCATCATCGAGAAC
ACCGGCCTGACCGCCTCCAACTCGATCTTCTACTCGGTCTTCATCGGCCTGATCAACCTG
GCCATGACCCTGGTCGCGGTGCGCTTCGTGGACCGCAAGGGGCGGCGGCCGCTGATGCTC
TTCTCGCTGACCGGGATGCTGCTCACGCTGATCCTGATGGGCCTCGCCTTCGTGGCGGAC
TTCAGCTCCGTCATCGCCCTCGTCTTCATGGTCCTGTACATCGCCTCCTTCGCCGCGGGG
CTCGGCCCGGTGTTCTGGGTCCTGGTGGGCGAGGTCTTCCCGCCGTCGGTCAGGGCGGTC
GGCTCCAGCGCGGCCACCTCCGTCAACTGGCTCGCCAACTTCACCGTCGGCCTGGTCTTC
CTGCCGCTCGCCGACGCCATCGGCCAGGGCGAGACCTTCTGGATCTTCGCCGGGGTCTGC
GCCTTCGGGCTGTGGTTCGTCGCGAGGTACGTACCCGAGACGCGCGGCGCGAGCGCCGAG
GAGATCCAGGAGGGGCTGGCGAAACGCTTCCACCGCGGGGGCGGGACGAGCGCGGGACGT
GGTGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003663 Sugar/inositol transporter (Family)
 [37-47]  1.3e-28 PR00171 [120-139]  1.3e-28 PR00171 [282-292]  1.3e-28 PR00171 [367-388]  1.3e-28 PR00171 [390-402]  1.3e-28 PR00171
PR00171   SUGRTRNSPORT
 [25-462]  4.1e-121 TIGR00879
TIGR00879   SP: MFS transporter, sugar porter (SP) family
IPR005828 General substrate transporter (Family)
 [29-464]  1.4e-116 PF00083
PF00083   Sugar_tr
IPR005829 Sugar transporter, conserved site (Conserved_site)
 [125-150]  PS00217
PS00217   SUGAR_TRANSPORT_2
 [83-100]  PS00216
PS00216   SUGAR_TRANSPORT_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-464]  5e-92 SSF103473
SSF103473   MFS general substrate transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [29-455]  60.634 PS50850
PS50850   MFS
SignalP No significant hit
TMHMM
 [31-53]  Transmembrane (i-o) [68-87]  Transmembrane (o-i) [96-115]  Transmembrane (i-o) [119-141]  Transmembrane (o-i) [154-176]  Transmembrane (i-o) [181-203]  Transmembrane (o-i) [271-293]  Transmembrane (i-o) [308-330]  Transmembrane (o-i) [337-359]  Transmembrane (i-o) [364-386]  Transmembrane (o-i) [399-421]  Transmembrane (i-o) [426-448]  Transmembrane (o-i)
Transmembrane 12